1) Edman's reagent is used in sequencing of amino acids. It cleaves one amino acid each from the amino terminal or n-terminus.
2) Cyanogen bromide cleaved the peptide bond from the C terminus of the aminoacid methionine. The cyanogen bromide cleavage produces the following sequences,
Edmans reaction will produce D, K, T, and L.
3) Chymotrypsin cleaves on the C terminal of phenyl alanine, tryptophan and tyrosine. There are no such amino acids in the given peptide structure. So, the Edmans reaction will produce D, M, K and T.
4) Trypsin cleaves at C terminus of lysine and arginine. So, the peptide sequences are,
The Edmans reaction will produce D, T, S
You have a peptide whose sequence is secretly known, that you want to analyze. The peptide...
Please explain each part !! Thank you !!
#3. Under experimental conditions, you purify a known, biologically important peptide from human tissue. To determine the overall sequence, you then digest the pure peptide with trypsin and chymotrypsin (each separately) and then use mass spectrometry to identify the following sequence fragments from the overall peptide (shown in order of relative length, not necessarily in the order in which they are assembled in the whole, natural peptide). Trypsin cleavage products: Chymotrypsin cleavage...
5. (15 pts) You have been given a peptide for analysis. (1) Write out the six key steps to determine the sequence of a protein as discussed in the lecture. (2) What is the sequence of a peptide based on the following experimental results: (indicate your logic by placing a letter corresponding to the data set in parentheses above the amino acid in the sequence. This is required for full credit) a) Its amino acid composition is M+L+Y+C+S+2K. b) Treatment...
Explain this question please!
Name (4 ofer to the Table of Amino Acids at the beginning of the exam to help solve this problem. Polypeptide I is a 12-mer and has the following amino acid composition: Ala, Arg, 2 His, Leu, 2 Lys, 2 Phe, Ser, Thr, Trp Edman degradation of I shows that its N-terminal amino acid is His. Chymotrypsin cleavage of I yields peptide fragments A-D.Trypsin cleavage of I gives peptide fragments E-G. Shown below is the amino...
1) (10 pts) Serine proteases are enzymes that cleave peptide bonds in proteins. Explain using words (drawings OR both) why serine proteases cleave either before or after different amino acid residues. Talk about at least two of the following proteases: Chymotrypsin, Trypsin, or Elastase. mod 2) (10pts) Below is a hypothetical peptide sequence. Give the peptide fragments that will occur by enzymatic degradation using Trypsin and Chymotrypsin DARSKWKSENLIRTY 3) (10 pts) All superfamilies of serine proteases use the catalytic triad...
biochemistry please show your work
2. A mutant form of polypeptide hormone angiotensin II has the amino acid composition: Ile, Arg, Met, Leu, Phe, Asp, Tyr, and Val. The following observations are made: 1) Treatment with trypsin yields a dipeptide containing Asp and Arg, and a hexapeptide with all the rest. 2) Cyanogen bromide yields a dipeptide containing Phe and Leu and a hexapeptide containing all the rest. 3) Chymotrypsin cleaves the hormone into two tetrapeptides of composition: Val, Tyr,...
Imagine that you have just isolated a peptide hormone with the following primary sequence: MLSCRLQEALAALSKIVLADLGCVTGAPSDPR (Assume the protein is in solution at physiological pH, and remember to include the amino acids at each end of the chain. A charge may come from the R-group, the N-terminus, and/or the C-terminus. If a residue occurs more than once, include each one in your answer.) List the residues (individual amino acids) that contribute a positive charge: List the residues that contribute a...
3. Amino acid analysis of a peptide seven residues long gave: Asp, Leu, Lys, Met, Phe, Tyr The following facts were observed: a. Trypsin treatment had no apparent effect b. Reaction with phenylisothiocyanate reagent yielded PTH-Phe c. Treatment with chymotrypsin yielded several products, including a dipeptide and a tetrapeptide. The amino acid composition of the tetrapeptide was Leu, Lys and Met. d. Cyanogen bromide treatment yielded a dipeptide, a tetrapeptide, and free lysine. What is the...
Biochemistry project 2 To have manageable peptides for sequencing by Edman Degradation, you first reduced all of the disulfide bonds and then digested the protein with cyanogen bromide. You then isolated one of the peptide fragments from this digest by isoelectric focusing, split it into two aliquots, and subjected one aliquot to tryptic digest and one aliquot to chymotryptic digest. After isolating all of the peptides from these digests, you sequence the peptides. The following are the sequences you obtained...
6. The sequence of kassinin, a tachykinin dodecapeptide from the African frog Kassina senegalensis, was determined. A single round of Edman degradation identifies Asp as the N-terminus. A second sample of the peptide is treated with chymotrypsin. Two fragments are released with the following amino acid compositions: fragment I (Gly, Leu, Met, Val) and fragment II (Asp2, Gln, Lys, Phe, Pro, Ser, Val). Next, a third sample of peptide is treated with trypsin, which results in two fragments with the...
Matching... Write the letter beside that which best describes the following. 1. _____ b-mercaptoethanol a. recognizes LVPRGS and cleaves the R-G peptide bond 2. _____ chymotrypsin b. purification technique used to separate proteins on the basis of charge 3. _____ trypsin c. utilizes DNA manipulation to co-express functional protein attachment 4. _____ cyanogen bromide d. purification technique used to separate proteins on the basis of size 5. _____ sodium dodecylsulfate e. is an example of an amphipathic molecule used...