Use python 2.7 to write this code: This code takes in a bunch of protein sequences as input listed below and tracks the highest average TM value (number under each protein) and If a protein has the highest TM value of all proteins found so far, track it. At the very end, the program should print out that as well:
For example, at the very end when run, it should print something like this:
Protein with the highest TM value: Protein 18: MFFFFKK...|
Average TM value: 0.6
test code to run the code:
AverageTMValues=
protein 1:'MKLVVRPWAGCWWSTLGPRGSLSPLGICPLLMLLWATLR'
aveTMValue:0.6
protein2:'MARKCSVPLVMAWLTWTTSRAPLPH',
aveTMValue: 0.5
protein3:'MPWPTSITXXXXXXSWSPEWLSSGLRSILGWEQPRVSHKGHSHEWHRRP'
aveTMValue:0.1
protein4: 'MAVLHAGRLHVSADRAGLPHQLPHALRHRPAQEAAHASQLHPAQPSRG'
aveTMValue:0.5
HighestAverageTMvalue=highestAveTMValue(AverageTMValues)
The code should output/print out: (it should also print out the protein corresponding with the highest TM value)
protein 1:'MKLVVRPWAGCWWSTLGPRGSLSPLGICPLLMLLWATLR'
aveTMValue:0.6
clearly show work and run it. THANK YOU a ton!!
Screenshot

Program
#Function to find highest average TM value from the passed
list
def highestAveTMValue(AverageTMValues):
#index start
i=1
#result index
index=i
#set highest TM
avg=float(AverageTMValues[i].split(':')[1])
#Loopuntil end of the list
while(i<len(AverageTMValues)):
#Compare average with
eac protein averages in the list
#Accordingly change
index and average
if(avg<float(AverageTMValues[i].split(':')[1])):
avg=float(AverageTMValues[i].split(':')[1])
index=i
i=i+2
#Return protein details
return
AverageTMValues[index-1]+"\n"+AverageTMValues[index]
#Test list
AverageTMValues=["protein
1:'MKLVVRPWAGCWWSTLGPRGSLSPLGICPLLMLLWATLR'","aveTMValue:0.6",
"protein2:'MARKCSVPLVMAWLTWTTSRAPLPH'","aveTMValue:0.5",
"protein3:'MPWPTSITXXXXXXSWSPEWLSSGLRSILGWEQPRVSHKGHSHEWHRRP'","aveTMValue:0.1",
"protein4:'MAVLHAGRLHVSADRAGLPHQLPHALRHRPAQEAAHASQLHPAQPSRG'","aveTMValue:0.5"]
#Call method
HighestAverageTMvalue=highestAveTMValue(AverageTMValues)
#Display result
print(HighestAverageTMvalue)
Output
protein 1:'MKLVVRPWAGCWWSTLGPRGSLSPLGICPLLMLLWATLR'
aveTMValue:0.6
Use python 2.7 to write this code: This code takes in a bunch of protein sequences...
USE Python 2.7(screen shot code with indentation and output exactly in the question) the task is: takes in a list of protein sequences as input and finds all the transmembrane domains and returns them in a list for each sequence in the list with given nonpolar regions and returns the lists for those. 1. This code should call two other functions that you write: regionProteinFind takes in a protein sequence and should return a list of 10 amino acid windows,...
USE Python 1. Assign value 555 to the variable x, write code to square the variable x and print out the result. 2. Given a string x, write a program to check if its first character is the same as its last character. If yes, the code should output "True" . 3. We defined two variables, x = 'Python' and y = '3.0'. Write code to concatenate the two numbers (the result should be 'Python3.0').
Write a python program where you create a list (you an create it in code you do not have to use input() statements) that represents the total rainfall for each of 12 months (assume that element 0 is January and element 11 is December). The program should calculate and display the: 1) total rainfall for the year; 2) the average monthly rainfall; 3) the months with the highest and lowest amounts. You need to figure out how to access each...
Write python code on computer, No handwritten
code
You will implement a program which asks the user to enter scores of different courses in different semesters. The program should read the input and output some simple statistics 1. An example input string by the user is given below. Fal12016-coursel:82, course2:80,course3:85;Spring2018- course4:82;Fall2018-course5:85, course6:50, course7:78 Info from different semesters are separated by a ";", courses in each semester are separated by a,and score and corresponding course is separated by a, information of...
Write a Python class called polynomial that represents a polynomial in the following fashion, The initializer of your polynomial class will be designed to take any number of numeric coefficients, The coefficient with the highest power will be the first coefficient. The last coefficient will be the constant value, that is, the value that is associated with . power 0. • Therefore, the number of the coefficients specified will directly indicate the highest power of the polynomial to be represented....
Use python to code!
Q1 - You need to keep track of book titles. Write code using
function(s)
that will allow the user to do the following.
1. Add book titles to the list.
2. Delete book titles anywhere in the list by value.
3. Delete a book by position.
Note: if you wish to display
the booklist as a vertical number booklist , that is ok
(that is also a hint)
4. Insert book titles anywhere in the list....
Python please help! Thanks you
Write a code to get an unlimited number of grades from the user (the user can press enter to finish the grades input, or use a sentinel, for example-1), and then calculate the GPA of all the grades and displays the GPA To do this you might need some help. Try to follow the following process (and check your progress by printing different values to make sure they are as they supposed to be): 1-...
Python GPA calculator: Assume the user has a bunch of courses they took, and need to calculate the overall GPA. We will need to get the grade and number of units for each course. It is not ideal to ask how many courses they took, as they have to manually count their courses. Programming is about automation and not manual work. We will create a textual menu that shows 3 choices. 1. Input class grade and number of units. 2....
how
to make my code of python work probely
my q is how to write a code to find the average actual water
level, average error by using python
and my program should be flexible where user can select the
column no. If you can see in the main program, it asked which
column to know the maximum or average, the column number is passed
to the function. The function should look which column to do.
#THIS PROGRAMMING IS ABLE...
Please answere using python language codes. Write a program to print out Collatz sequence for a user-supplied number. Prompt the user for a positive integer which will become the first number in the sequence. Next number in the sequence is derived as follows: If previous number is odd, the next number is 3 times the previous, plus 1. If previous number is even, the next number is half of the previous According to Collatz proposition, the sequence ultimately reaches 1...