We need at least 10 more requests to produce the answer.
0 / 10 have requested this problem solution
The more requests, the faster the answer.
The chemical hydroxylamine is used to cleave only at asparagine-glycine bonds. What would be the correct...
The chemical hydroxylamine is used to cleave only at asparagine-glycine bonds. What would be the correct peptide fragments formed if Asp-Gly-Asn-Gly-Asn-Gly-Pro was treated with hydroxylamine? Asp-Gly-Asn Gly-Asn Gly-Pro Asp Gly Asn-Gly Asn-Gly-Pro Asp Gly-Asn Gly-Asn Gly-Pro O Asp-Gly-Asn-Gly-Asn-Gly-Pro
please help with these 5
questions
Consider a polypeptide consisting of 19 amino acid residues. Its structure is shown below. Lys-Tyr-Gly-Gly-Phe-Leu-Arg-Arg-Ile-Arg-Pro-Lys-Leu-Lys-Trp-Asp-Asn-Gln-Tyr . Draw the fragments that would result if the peptide was treated with trypsin. (No partial credit) . Draw the fragments that would result if the peptide was treated with chymotropsin. (No partial credit) MATCH a term from the list below to each definition. Place the letter of the term in the blank to the left of the definition...
please explain each question thoroughly. thanks
Question 3: Arg-Cys-Met-Ala-Cys-Gly-Arg-Pro-Asn-Tyr-Leu-Trp-Ala-Ile-His-Phe-Ser-Cys-Lys a. What would happen if this peptide were to be incubated with dinitrofluorobenzene (FDNB) followed by 6M HCl hydrolysis at 1100C for 24 hrs. What labeled product(s) would be detected? Consider the following pepide: What would happen if the peptide were treated with CNBr? What would the products be? Why? b. What would happen if the peptide were treated with chymotrypsin? What would the c. products be? Why? Arg-Cys-Met-Ala-Cys-Gly-Arg-Pro-Asn-Tyr, Leu-Trp, Ala-Ile-His-Phe,...
please answer all!
The dipeptide, Glu-Asn would be most soluble in which solvent system? water and benzene water and sulfuric acid water and butanol water and vinegar (acetic acid) Question 10 Thrombin is an enzyme seen in the blood clotting cascade. It cleaves proteins on the carboxyl side of arginine residues. How many peptide fragments would be formed if Lys-His-Pro-Arg-His was treated with thrombin? Thrombin would not cleave this polypeptide, since there are no arginine residues. 0 1 2 3...
What fragments will be obtained by a trypsin hydrolysis of the following octapeptide? Ala-Val-Trp-Lys-Phe-Gly-Arg-Met A) Ala-Val-Trp-Lys-Phe and Gly-Arg-Met 3) Ala-Val-Trp-Lys-Phe-Gly and Arg-Met - Ala-Val-Trp-Lys and Phe-Gly-Arg and Met ) Ala-Val-Trp-Lys and Phe and Gly-Arg and Met ) Ala-Val-Trp and Lys-Phe-Gly and Arg-Met Bradykinin is a nonapeptide, Arg-Pro-Pro-Gly-Phe-Ser-Pro-Phe-Arg. In addition to one mole of Arg, what peptides are present after hydrolysis of bradykinin with chymotrypsin? A) Arg-Pro-Pro and Gly-Phe and Ser-Pro-Phe B) Pro-Pro-Gly and Phe-Ser-Pro-Phe-Arg C) Arg-Pro-Pro-Gly-Phe and Ser-Pro-Phe ?) Arg-Pro-Pro-Gly-Phe-Ser...
The chemical structures of the 20 standard amino acids at pH 7, along with their 3 and 1 letter codes, are givern in alphabetical order below. While the oxygen and nitrogen atoms of the peptide bonds may serve as a donor atom to complex a metal ion, very often the ligands for the metal come from the amino acid side chains. Takea few moments to examine the chemical structures of the different side chains. Circle the side chains that you...
A chain GIVEQCCASVCSLYQLENYCN B chain FVNQHLCGSHLVEALYLVCGERGFFYTPKA Shown above is the amino acid sequence of the hormone insulin. This structure was determined by Frederick Sanger and his coworkers. Most of this work is described in a series of articles published in the Biochemical Journal from 1945 to 1955. When Sanger and colleagues began their work in 1945, it was known that insulin was a small protein consisting of two or four polypeptide chains linked by disulfide bonds. Sanger and his coworkers...
10. The peptide shown has the amino acid sequence: A. Val-Ser-Ile-Glu-Lys B. Lys-Glu-Ile-Ser-Val C. Thr-Asp-Leu-Gln-Arg D. Val-Asp-Ile-Glu-Arg 11. Which of the following describes the entire three- dimensional structure of a single polypeptide? A. Secondary structure B. Quaternary structure C. Tertiary structure D. Primary structure 12. What is the primary driving force in the formation of protein tertiary structure? A. Energy released when additional ion pairs are formed. B. The exclusion of non-polar substances from aqueous solution. C. The formation of...
s smı peptdes and ultimately proteins through a condensation fatt similar to the reactions that form a triglyceride from glycerol Amino acids combine to form peptides an protonated aater molecule is removed when a carboxylate and and three fatty acids. One and thretis amine react. Figure 1: o- HI Carboxylate reacts with Protonated Amide forming amine 2. Consider the two amino acids, tryptophan and serine bonds can be formed between these acids? How many different peptide 3. Draw each of...
table for reference for question 4 table
h ell-free synoms produce Golshopecule consisting of a string of urucille RNA free systems produced the polypeptide poly string of phenylalanine amino acids phenylalanine ed entymes to produkce RNA polymers with they leotide. These polymers allowed them to inter to signal "start" and is therefore the art codon. In this case the as a dual function because also encodes the mind methionine (Met). You can see that 61 codons are more than enough...