Question

Consider the following structure: CHCH3 CH3 CH20H CH3 CH3 Which of the following correctly identifies the properties of this

0 0
Add a comment Improve this question Transcribed image text
Answer #1

CAH alin The

Add a comment
Know the answer?
Add Answer to:
Consider the following structure: CHCH3 CH3 CH20H CH3 CH3 Which of the following correctly identifies the...
Your Answer:

Post as a guest

Your Name:

What's your source?

Earn Coins

Coins can be redeemed for fabulous gifts.

Not the answer you're looking for? Ask your own homework help question. Our experts will answer your question WITHIN MINUTES for Free.
Similar Homework Help Questions
  • Complete hydrolysis of an unknown basic decapeptide gives Gly, Ala, Leu, Ile, Phe, Tyr, Glu, Arg,...

    Complete hydrolysis of an unknown basic decapeptide gives Gly, Ala, Leu, Ile, Phe, Tyr, Glu, Arg, Lys, and Ser. Problem 24-44 ConstantsI Periodic Table Complete hydrolysis of an unknown basic decapeptide gives Gly, Ala, Leu, lle, Phe, Tyr, Glu, Arg, Lys, and Ser. Terminal residue analysis shows that the N terminus is Ala and the C terminus is lle. Incubation of the decapeptide with chymotrypsin gives two tripeptides, A and B, and a tetrapeptide, C. Amino acid analysis shows that...

  • Question 5 (1 point) Saved What arrow correctly identifies a peptide bond? LED H2N -CH-CJN-CH-C-R-CHCN-CH-8 CH-OH...

    Question 5 (1 point) Saved What arrow correctly identifies a peptide bond? LED H2N -CH-CJN-CH-C-R-CHCN-CH-8 CH-OH - CH₂ CH3 Question 4 (1 point) Identify all the amino acids that can be produced using the three letter designation (Use your textbook). HN-CH-C-N-CH-C-N-CH-C-N-CH-C CH-OH CH, 0 0 Al...Gly...-Cys...-Ser Gly.-.-Ala----Glu ---Met Glu----Ala----Thr----Cys Ala-Gly-Thr-Tyr 0 0 Question 3 (1 point) Use the three letter designation for the amino acids to write the tetrapeptide order: HN-CH-C-N-CH-C-N-CH-C-N-CH-C 525-5 Ala...Gly...Cys-..-Ser Gly....Ala---- Glu---- Met Glu---- Ala...-Thr-Cys OCys...-Ala----Gly-Ser Question...

  • What fragments will be obtained by a trypsin hydrolysis of the following octapeptide? Ala-Val-Trp-Lys-Phe-Gly-Arg-Met A) Ala-Val-Trp-Lys-Phe...

    What fragments will be obtained by a trypsin hydrolysis of the following octapeptide? Ala-Val-Trp-Lys-Phe-Gly-Arg-Met A) Ala-Val-Trp-Lys-Phe and Gly-Arg-Met 3) Ala-Val-Trp-Lys-Phe-Gly and Arg-Met - Ala-Val-Trp-Lys and Phe-Gly-Arg and Met ) Ala-Val-Trp-Lys and Phe and Gly-Arg and Met ) Ala-Val-Trp and Lys-Phe-Gly and Arg-Met Bradykinin is a nonapeptide, Arg-Pro-Pro-Gly-Phe-Ser-Pro-Phe-Arg. In addition to one mole of Arg, what peptides are present after hydrolysis of bradykinin with chymotrypsin? A) Arg-Pro-Pro and Gly-Phe and Ser-Pro-Phe B) Pro-Pro-Gly and Phe-Ser-Pro-Phe-Arg C) Arg-Pro-Pro-Gly-Phe and Ser-Pro-Phe ?) Arg-Pro-Pro-Gly-Phe-Ser...

  • Question 5 Bio206 Homework 6 Amino Acids and Proteins Organic Chemistry II Due May 6, 2017 1. Which amino acid is least likely to be found in a natural protein? CH20H NHz CHs IV 2. A pentapeptide has...

    Question 5 Bio206 Homework 6 Amino Acids and Proteins Organic Chemistry II Due May 6, 2017 1. Which amino acid is least likely to be found in a natural protein? CH20H NHz CHs IV 2. A pentapeptide has the molecular formula: Asp, Glu, His, Phe, Val. Partial hydrolysis of the pentapeptide gives: Val Asp, Glu His, Phe Val, and Asp Glu. What is the amino acid sequence of the pentapeptide? 3. When the pentapeptide below is heated first with 2,4-dinitrofluorobenzene...

  • Protein Structure A protein contains a string of amino acids (usually more than 50) that has...

    Protein Structure A protein contains a string of amino acids (usually more than 50) that has a biological function. 15ecause proteins are so large, their structure has several levels, all of which are important for the proper functioning of the protein. Ultimately, the sequence of amino acids (ordering of polar and nonpolar amino acids) dictates the 3-dimensional shape of a protein and this dictates its primary function. Level 1: Primary (1") The amino acid sequence of a polypeptide Protein Backbone...

  • 6. The following polypeptide (30 amino acids) contains a great deal of regular secondary structure. (10)...

    6. The following polypeptide (30 amino acids) contains a great deal of regular secondary structure. (10) (15) (20) lys Lys Ala-Phe-Trp-Met-His- GIh-Thr-lle-Arg-Ser-Gly-Ala-Gly-Ser-Gly-Ala-Trp-Tyr-Pro-Val-Ala (30) Phe-Met-Leu-Val-Pro-Glu-Glu There are at least two regions where alpha helical structure is found. Indicate the beginning and ending residues of these regions. Any group or groups which break the alpha helical structure should not be considered part of the helix. Remember that it take four residues to give a turn of an alpha helix, so that is...

  • Consider the trypsin binding-pocket specificity structure scenario and critical AAs interactions ...

    Consider the trypsin binding-pocket specificity structure scenario and critical AAs interactions within: G226-D189-G216 (see slide): a single nucleotide polymorphism within the D189 codon resulted in a first nucleotide Guanine replacement by Cytosine. What is the consequence of this mutation relative to binding pocket- substrate specificity? Enzymes vary in specificity pocket Vary in amino acids in pocket Controls chemical environment Scissile bond Also controls pocket dimensions Chymotrypsin Gly residues make deep pocket Pocket fits aromatic ring Phe Gly 216 Trypsin Gly...

  • A chain GIVEQCCASVCSLYQLENYCN B chain FVNQHLCGSHLVEALYLVCGERGFFYTPKA Shown above is the amino acid sequence of the hormone...

    A chain GIVEQCCASVCSLYQLENYCN B chain FVNQHLCGSHLVEALYLVCGERGFFYTPKA Shown above is the amino acid sequence of the hormone insulin. This structure was determined by Frederick Sanger and his coworkers. Most of this work is described in a series of articles published in the Biochemical Journal from 1945 to 1955. When Sanger and colleagues began their work in 1945, it was known that insulin was a small protein consisting of two or four polypeptide chains linked by disulfide bonds. Sanger and his coworkers...

  • s smı peptdes and ultimately proteins through a condensation fatt similar to the reactions that form...

    s smı peptdes and ultimately proteins through a condensation fatt similar to the reactions that form a triglyceride from glycerol Amino acids combine to form peptides an protonated aater molecule is removed when a carboxylate and and three fatty acids. One and thretis amine react. Figure 1: o- HI Carboxylate reacts with Protonated Amide forming amine 2. Consider the two amino acids, tryptophan and serine bonds can be formed between these acids? How many different peptide 3. Draw each of...

  • The following genomic DNA sequence comes from the first exon of a human gene and contains...

    The following genomic DNA sequence comes from the first exon of a human gene and contains the 3'-end of the 5'-untranslated region and the start of a long open reading frame that codes for 200 amino acids (a.k.a. coding sequence). Note: There are no introns in this short portion and only one strand of the genomic DNA is shown. Which of the following answers lists the first three amino acids of the translated protein correctly? Seconed Position tyr ser leu...

ADVERTISEMENT
Free Homework Help App
Download From Google Play
Scan Your Homework
to Get Instant Free Answers
Need Online Homework Help?
Ask a Question
Get Answers For Free
Most questions answered within 3 hours.
ADVERTISEMENT
ADVERTISEMENT