Question

1.Under anaerobic conditions pyruvate is converted to acetly CoA True or false? 2.Expect for glycine, all...

1.Under anaerobic conditions pyruvate is converted to acetly CoA True or false?
2.Expect for glycine, all of the amino acids in a protein have the D configuration. True or false?
3.The side chain of the amino acid lysine is -CH2-CH2-CH2-CH2-NH2. TO which category does this amino acid belong?
4. which statment below describes the primary structure of a protien?
- peptide bonds join amino acids in a polypeptide chain?
- two polypeptide chains are held together by hydrogen bonds and other forces?
-side chains interact to form disulfide bonds

0 0
Add a comment Improve this question Transcribed image text
Answer #1

1. The statement is false.under anaerobic conditions pyruvate is converted to lactic acid or ethanol which depends on the organism. When Pyruvate is converted into the acetyl CoA , decarboxylation occurs and carbon dioxide is removed. It is the link between glycolysis and citric acid cycle. I happens in aerobic condition.

2.The statement is false. Glycine is optically inactive. And except glycine all other amino acids in a protein have the L configuration.

3.We can see that the side chain of the lysine contains the hydrocarbon chain. We know that the hydrocarbon is non-polar, Hydrophobic in nature. So the amino acid,lysine belongs to the hydrophobic amino acid category.

4.Peptide bonds join amino acid in a polypeptide chain- describes the primary structure of a protein.

Add a comment
Know the answer?
Add Answer to:
1.Under anaerobic conditions pyruvate is converted to acetly CoA True or false? 2.Expect for glycine, all...
Your Answer:

Post as a guest

Your Name:

What's your source?

Earn Coins

Coins can be redeemed for fabulous gifts.

Not the answer you're looking for? Ask your own homework help question. Our experts will answer your question WITHIN MINUTES for Free.
Similar Homework Help Questions
  • True or false? True False  Phenylalanine's side chain is more polar than tryptophan's or tyrosine's side chains....

    True or false? True False  Phenylalanine's side chain is more polar than tryptophan's or tyrosine's side chains. True False  Almost all peptide bonds in proteins are in the trans configuration. True False  In folded globular proteins, the side chains of hydrophobic amino acids are mostly buried in the interior of the protein. True False  The peptides I-A-G-Y-L-S and S-L-Y-G-A-I are different molecules with different properties. True False  Poly lysine will tend to form an alpha helix in solution at pH 6.8. True False  Amyloidoses such as...

  • A chain GIVEQCCASVCSLYQLENYCN B chain FVNQHLCGSHLVEALYLVCGERGFFYTPKA Shown above is the amino acid sequence of the hormone...

    A chain GIVEQCCASVCSLYQLENYCN B chain FVNQHLCGSHLVEALYLVCGERGFFYTPKA Shown above is the amino acid sequence of the hormone insulin. This structure was determined by Frederick Sanger and his coworkers. Most of this work is described in a series of articles published in the Biochemical Journal from 1945 to 1955. When Sanger and colleagues began their work in 1945, it was known that insulin was a small protein consisting of two or four polypeptide chains linked by disulfide bonds. Sanger and his coworkers...

  • Please answer all Questions QUESTION 10 2.5 points Save Answer The following is an amino acid...

    Please answer all Questions QUESTION 10 2.5 points Save Answer The following is an amino acid True False QUESTION 11 2.5 points Save Answer This compound would be a likely component of the lipid bilayer of cell membranes H-C-O нсо H.coi True False QUESTION 12 2 .5 points Save Answer Branched chain amino acids refer to An amino acid capable of forming two amide bonds (i.e., branched polypeptide) O an amino acid with a fatty acid chain O an amino...

  • 1. Which is a true statement about amino acids? a. They are amphiprotic b. The a-carbon...

    1. Which is a true statement about amino acids? a. They are amphiprotic b. The a-carbon has an ester attached c. They are symmetrical d. They are planar e. The α-carbon has a phosphate group attached 2. Which is an incorrect statement regarding the side chains of amino acids? a. Tryptophan, tyrosine, and phenylalanine contain an aromatic group. b. Isoleucine, and leucine are isomers of each other. c. Lysine and methionine contain an amine group. d. Threonine, serine, and tyrosine...

  • helppp!! true or false 15. The oxidation of pyruvate to acetyl-CoA generates 1 ATP, 1 NADH...

    helppp!! true or false 15. The oxidation of pyruvate to acetyl-CoA generates 1 ATP, 1 NADH and 1 CO2 per molecule 16. Two molecules of ATP and two NADH are produced in the molecule. alcoholic fermentation process. 17. Lactic fermentation can generate CO2 18. Lipases are enzymes that help to break down the glycerol of the fatty acids in DHAP 19. The molecules DHAP and G3P are isomers. 20. Proteins can be used as fuel for cellular respiration and their...

  • 1. Given the following peptide, which of the following statements is true? Question options: a) The...

    1. Given the following peptide, which of the following statements is true? Question options: a) The N-terminal residue is leucine. b)This peptide contains 4 amino acid residues. c) The peptide contains a total of 6 ionizable groups. d) The net charge of this peptide at pH 7 is +1 Locate any peptide bond along the backbone of the given peptide. e) The bond between the C (of the C=O) and the N (of the N-H) of a peptide bond has...

  • points each) 1. Saturated fatty acids contain carbon - carbon double bonds. True False 2. The...

    points each) 1. Saturated fatty acids contain carbon - carbon double bonds. True False 2. The citric acid cycle generates the most energy in metabolism. True False 3. Glycolysis results in a net energy gain of 2 ATP and 2 NADH. True False 4. Complex Il in the electron transport chain is part of the citric acid cycle. True False Complete the following statements with high, low, increase or decrease. Each word may be used multiple times. Each blank is...

  • please number answers 1. Which is the basic ring system of the steroids? 0000 "acto 12....

    please number answers 1. Which is the basic ring system of the steroids? 0000 "acto 12. The catalytic hydrogenation of vegetable oils will produce (1) fatty acids. (3) fats. (2) fatty acids and (4) waxes. glycerol. 13. The melting point of an unsaturated glyceryl ester compared to that of its saturated hydrogenation product is usually (1) Tower. (3) the same. (2) higher. (4) unpredictable. 14. Which best represents the amino acid glycine at its isoelectric point? (1) HyNCH2COOH (2) H3TNCH,COOH...

  • Nehydration synthesis dissolve in water, c) are one di Decause they a soluble in the Fatty...

    Nehydration synthesis dissolve in water, c) are one di Decause they a soluble in the Fatty Acids of the bilayer 8. A molecule composed of carbon hydrogen, and oxygen in a 12:1 ratio is a (n) a) on / in acid b) id c) protei n onosaccharide 9. Which of the following molecule es that are hypothesized to have fomed spontaneously in the Earth's period of Chemical evolution served as a universal sole CH Ob) CO O O , e...

  • Can someone please check my answers and aid in #12? 1. The amide nitrogen of glutamine:...

    Can someone please check my answers and aid in #12? 1. The amide nitrogen of glutamine: A. represents a nontoxic transport form of ammonia. B. is a major source of ammonia for urinary excretion. C. is used in the synthesis of asparagine, purines, and pynimidines. D. can be recovered as ammonia by the action of glutaminase. E. all of the above are correct. 2- Which of the following statements about glutamate is NOT true: a It can be synthesized in...

ADVERTISEMENT
Free Homework Help App
Download From Google Play
Scan Your Homework
to Get Instant Free Answers
Need Online Homework Help?
Ask a Question
Get Answers For Free
Most questions answered within 3 hours.
ADVERTISEMENT
ADVERTISEMENT