Which one would elute first on GC (gas Chromatography, hexane or toluene? why?

Question

Question

science chemistry

Answer 1

Answer #1

Answer 2

Similar Homework Help Questions

Why does the Toluene elute before Mesitylene on the GC. These are the results of the...

Why does the Toluene elute before Mesitylene on the GC. These are the results of the GC-MS chromatogram. Please help.
Between benzophenone and 4-nitro benzaldehyde which compound is more polar and which compound would elute first...

Between benzophenone and 4-nitro benzaldehyde which compound is more polar and which compound would elute first in column chromatography, which compound would be higher on a TLC plate and why?
In gas chromatography (GC), why do we use a FAME standard instead of an alkane standard...

In gas chromatography (GC), why do we use a FAME standard instead of an alkane standard and how can we still use this to calculate a retention index?

Which is more polar and why? - Ferrocene, acetylferrocene or diacetylferrocene Which compound would elute off...

Which is more polar and why? - Ferrocene, acetylferrocene or diacetylferrocene Which compound would elute off a column first and which compound would elute off a column last and why?
Which of the following peptides will elute first in size-exclusion chromatography? Peptide 1: ASDCFRTYEWQCVNMKHFYLP Peptide 2:...

Which of the following peptides will elute first in size-exclusion chromatography? Peptide 1: ASDCFRTYEWQCVNMKHFYLP Peptide 2: AWSDEGYIMN Peptide 3: MKLLVTYYICDEEPAQR Peptide 4: FVCCNTTRLEWWQNMSCKLAAPICNMRTTY O Peptide 1 Peptide 2 Peptide 3 Peptide 4
can I have help on question 5 please? Chemistry 70A Experiment 5 - Distillation Fall 2019...

can I have help on question 5 please? Chemistry 70A Experiment 5 - Distillation Fall 2019 5. (4 pts) For gas chromatography, what four factors determine the retention time for organic compounds moving through the column?! 6. (2 pts) Cyclohexane was the first compound to "elute" from the the gc column. Suggest some reasons why cyclohexane elutes before toluene.

why would HCl be an inappropriate solvent to elute Cr(III) complexes from a column during ion...

why would HCl be an inappropriate solvent to elute Cr(III) complexes from a column during ion exchange chromatography?
Gas Chromatography You inject your sample into the GC and then wait several minutes, but you...

Gas Chromatography You inject your sample into the GC and then wait several minutes, but you see no peak. What should you do?
Chromatography I Questions Name CHE 201 Date The following solvent systems were found to separate compounds...

Chromatography I Questions Name CHE 201 Date The following solvent systems were found to separate compounds A and B by column chromatography: • A: hexane/ethyl acetate 10:1 • B: hexane/ethyl acetate 10:5 Which is the more polar compound, A or B? Explain your answer for credit, 2) In order to separate a mixture of A and B as in problem (1) by column chromatography: a. Which solvent system must be used first? Why? b. Which compound will elute from the...

Gas Chromatography 1. A sample of a mixture of ethyl acetate (Rt = 1.67 min) and...

Gas Chromatography 1. A sample of a mixture of ethyl acetate (Rt = 1.67 min) and toluene (Rt = 2.65 min) was analyzed by gas chromatography and the following results obtained: Peak # Time [min] Area (uV sec) Area [%] 8.703 1.32 3708 1.67 16449 38.61 52.69 2.65 22449 a. Provide one explanation why three signals were obtained b. What is the normalized percentages of ethyl acetate and toluene.