Question

Write the Python Function program to find the RRi of Given Protein Sequence.

input: Two inputs will be one is Sequence and the other is Amino Acid.

Output: RRi

Example: Here input is a different sequence and Amino acid is "A".

This means for a given residue type, minimum RRI will be 1 and maximum will be total number of that type of residues in seque

Code Example :

def Function(Sequence,AminoAcide):

# Your Code

0 0
Add a comment Improve this question Transcribed image text
Answer #1

#FUNCTION to calculate RRI

def calRRI(sequence,acid):
res=0
count=0
l = []
u=0
d=0
for x in sequence:
if(x == acid):
count+=1
elif(count>0):
l.append(count)
count=0
for x in l:
u+=(x**2)
d+=x
  
res = u/d
return res

seq = input("Enter Sequence: ")
acid = input("Enter acid character: ")
rri = calRRI(seq,acid)
print(rri)

Add a comment
Know the answer?
Add Answer to:
Write the Python Function program to find the RRi of Given Protein Sequence. input: Two inputs...
Your Answer:

Post as a guest

Your Name:

What's your source?

Earn Coins

Coins can be redeemed for fabulous gifts.

Not the answer you're looking for? Ask your own homework help question. Our experts will answer your question WITHIN MINUTES for Free.
Similar Homework Help Questions
  • python Write a function that takes as input a single integer parametern and computes the nth...

    python Write a function that takes as input a single integer parametern and computes the nth Fibonacci Sequence number The Fibonacci sequence first two terms are 1 and 1(so, if n - 2 your function should return 1). From there, the previous two values are summed to come up with the next result in the sequence 1.1,2,3,5,8,13, 21, 34, 55, etc.) For example, if the input is 7 then your function should return 13 26561.1615880 1 def Fibonacci(n): # your...

  • Imagine that you have just isolated a peptide hormone with the following primary sequence: MLSCRLQEALAALSKIVLADLGCVTGAPSDPR (Assume...

    Imagine that you have just isolated a peptide hormone with the following primary sequence: MLSCRLQEALAALSKIVLADLGCVTGAPSDPR (Assume the protein is in solution at physiological pH, and remember to include the amino acids at each end of the chain. A charge may come from the R-group, the N-terminus, and/or the C-terminus. If a residue occurs more than once, include each one in your answer.) List the residues (individual amino acids) that contribute a positive charge: ​ List the residues that contribute a...

  • Find the two other segments of the sequence among your classmates that will complete the protein....

    Find the two other segments of the sequence among your classmates that will complete the protein. For example if you have a middle segment you will need to find a beginning and an end segment. Write the entire linear order of amino acids in Part 2, Question l in your proforma, (using the single letter amino acid abbreviation). Start with the beginning segment, followed by the middle segment and lastly, the end segment. Indicate the amino (NH2) and carboxyl (COOH)...

  • 1. How can protein folding affect protein function? 2. How can amino acid sequence affect protein...

    1. How can protein folding affect protein function? 2. How can amino acid sequence affect protein function? 3. How can an amino acid sequence (primary sequence) dictate 3D protein structure?

  • Python 3 code Write a function named coinflip that accepts an input called flips. The function...

    Python 3 code Write a function named coinflip that accepts an input called flips. The function should sim-ulate flipping a coin flips times. The function should return True if the coin was the same result for every flip. You can assume the function receives a positive integer as input. Write a second function named simulation that runs trials of the coin flip experiment. simulation should accept two parameters: the number of trials, and the number of coin flips to do...

  • write the following code in python 3.2+. Recursive function prefered. Thank you! Define a function named...

    write the following code in python 3.2+. Recursive function prefered. Thank you! Define a function named q3() that accepts a List of characters as a parameter and returns a Dictionary. The Dictionary values will be determined by counting the unique 3 letter combinations created by combining the values at index 0, 1, 2 in the List, then the values at index 1, 2, 3 and so on. The q3() function should continue analyzing each sequential 3 letter combination and using...

  • Three samples of tropomyosin fragments have been measured, one wild type and two mutants: Tpm WT,...

    Three samples of tropomyosin fragments have been measured, one wild type and two mutants: Tpm WT, Tpm R91C and Tpm R91P. This fragment should form a coiled coil structure, therefore we expect to see spectra typical for alpha-helices. Our task is to find out if the mutations affect the structure and stability of this protein. Wild type sequence: GSHMCGGLKDAQEKLELAEKKAADAEAEVASLNRRIQLVEEELDRAQERLATALQKLEEAEKAA DESERGMKVIENRALKDEEKMELQEIQLKEAKHI 1. (15 points) Show sequences of all fragments aligned (R is the only residue to change; use courier font for...

  • Example question (p. 171). The amino acid sequence of a wild-type protein is Met-His-Ala-Trp-Asn-Gly-Glu–His-Arg The amino...

    Example question (p. 171). The amino acid sequence of a wild-type protein is Met-His-Ala-Trp-Asn-Gly-Glu–His-Arg The amino acid sequences of two mutants are: Mutant 1: Met-His-Ala-Trp-Lys-Gly-Glu–His-Arg Mutant 2: Met-His-Ala For each mutant, specify the type of mutation that has occurred, using the mutation classification system based on effect to protein function

  • Write a program in python that asks the user to input a sentence. The program will...

    Write a program in python that asks the user to input a sentence. The program will ask the user what two letters are to be counted. You must use a “for” loop to go through the sentence & count how many times the chosen letter appears in the sentence. You are not allowed to use python built-in function "count()" or you'll get a Zero! Output will show the sentence, the letter, and the number of times the letter appears in...

  • In Python 3 - Write a program that reads a sequence of integer inputs from the...

    In Python 3 - Write a program that reads a sequence of integer inputs from the user. When the user is finished entering the integers, they will enter a 'q'. There is no need to check if the entry is a valid integer. All integers in the test data (input) will be between -255 and 255. The program should then print: The smallest and largest of the inputs. The number of even and odd inputs (0 should be considered even)...

ADVERTISEMENT
Free Homework Help App
Download From Google Play
Scan Your Homework
to Get Instant Free Answers
Need Online Homework Help?
Ask a Question
Get Answers For Free
Most questions answered within 3 hours.
ADVERTISEMENT
ADVERTISEMENT