Question

Imagine that you have just isolated a peptide hormone with the following primary sequence: MLSCRLQEALAALSKIVLADLGCVTGAPSDPR (Assume...

Imagine that you have just isolated a peptide hormone with the following primary sequence:

MLSCRLQEALAALSKIVLADLGCVTGAPSDPR

(Assume the protein is in solution at physiological pH, and remember to include the amino acids at each end of the chain. A charge may come from the R-group, the N-terminus, and/or the C-terminus. If a residue occurs more than once, include each one in your answer.)

List the residues (individual amino acids) that contribute a positive charge: ​
List the residues that contribute a negative charge: ​
Which residues can be connected by a disulfide bond? (Only type the letter.) ​
What would the NET charge of this peptide be at physiological pH?

0 0
Add a comment Improve this question Transcribed image text
Answer #1

- residues that contribute positive charges : histidine(H), lysine(K), arginine(R).

- residues that contribute negative charges : aspartic acid(D), glutamic acid(E).

- the residues that can be connected by disulphide bond is cysteine (C).

- net charge : zero

Add a comment
Know the answer?
Add Answer to:
Imagine that you have just isolated a peptide hormone with the following primary sequence: MLSCRLQEALAALSKIVLADLGCVTGAPSDPR (Assume...
Your Answer:

Post as a guest

Your Name:

What's your source?

Earn Coins

Coins can be redeemed for fabulous gifts.

Not the answer you're looking for? Ask your own homework help question. Our experts will answer your question WITHIN MINUTES for Free.
Similar Homework Help Questions
  • As a biochemist, you isolate and begin to study the biochemical properties of a peptide hormone...

    As a biochemist, you isolate and begin to study the biochemical properties of a peptide hormone with the following sequence: (Assume the residues are numbered 1 through 30, left to right. For example, the last residue would be named “T30”) A D S E R N C Q L V I L L A W L P G V K V Q C A L L D R E T (a) List all of the residues that could contribute a...

  • A chain GIVEQCCASVCSLYQLENYCN B chain FVNQHLCGSHLVEALYLVCGERGFFYTPKA Shown above is the amino acid sequence of the hormone...

    A chain GIVEQCCASVCSLYQLENYCN B chain FVNQHLCGSHLVEALYLVCGERGFFYTPKA Shown above is the amino acid sequence of the hormone insulin. This structure was determined by Frederick Sanger and his coworkers. Most of this work is described in a series of articles published in the Biochemical Journal from 1945 to 1955. When Sanger and colleagues began their work in 1945, it was known that insulin was a small protein consisting of two or four polypeptide chains linked by disulfide bonds. Sanger and his coworkers...

  • You have a peptide whose sequence is secretly known, that you want to analyze. The peptide...

    You have a peptide whose sequence is secretly known, that you want to analyze. The peptide sequence is D-M-K-T-L-A-R-S-M-E-I-D-Q You have three reagents that cleave polypeptides, CNBr, chymotrypsin, and trypsin into smaller peptides. If you could purify these peptides and sequence them by Edman, but only get four amino acids. 1) what end of the protein does the Edman reaction cleave residues from? n-terminus or c-terminus 2) what are all the Edman sequences (up to 4 amino acids) of the...

  • please answer thoroughly and correctly thjs js my last try Vasopressin is a peptide hormone synthesized...

    please answer thoroughly and correctly thjs js my last try Vasopressin is a peptide hormone synthesized by the hypothalamus; in its reduced form it has the structure shown. NH2 HS H H₂N н NH2 SH H NH2 OH Vasopressin NH *H N NH2 This structure is incorrect in that one of the amino acids is shown in the D-configuration, rather than the L. Which one is it? What is the amino acid sequence of this peptide? CYFONCPRG Enter your answer...

  • help with these please Examine the peptide. Thr-Glu-Pro-Ile-Val-Ala-Pro-Met-Glu-Tyr-Gly-Lys Write the sequence using one-letter abbreviations. sequence: TKPIVAPMEYGK...

    help with these please Examine the peptide. Thr-Glu-Pro-Ile-Val-Ala-Pro-Met-Glu-Tyr-Gly-Lys Write the sequence using one-letter abbreviations. sequence: TKPIVAPMEYGK Estimate the net charge on the peptide at pH 7. charge at pH 7: Estimate the net charge on the peptide at pH 12. Alpha helices are a type of secondary structure in proteins. What is the length of a 23.0 kDa single-stranded a-helical protein segment? Assume a mean residue mass of 110 Da. length: Beta () sheets are a type of secondary structure...

  • 12. Below is a portion of the abstract of a journal article. It describes the isolation,...

    12. Below is a portion of the abstract of a journal article. It describes the isolation, purification, and determination of the peptide sequence as well as, the location of each of the disulfide bridges of an antibacterial peptide from the cowpea plant. Give brief and to the point answers to the questions based upon this information. (2 pts) FEBS Joumal 273 (2006) 3489-3497 2006 The Authors Journal compilation2006 FEBS Identification of a cowpea y-thionin with bactericidal activity Octávio L. Franco,...

  • 6. Islet amyloid polypeptide (IAPP), often called amylin, is a peptide hormone that is co-secreted with...

    6. Islet amyloid polypeptide (IAPP), often called amylin, is a peptide hormone that is co-secreted with insulin from pancreatic B-cells. In combination, insulin and amylin regulate blood glucose levels. In this signaling process, amylin participates in slowing gastric emptying and promoting satiety, helping to prevent spikes in blood glucose levels. Using your knowledge of protein sequencing and proteomics, answer the questions below related to amylin. A. Islet amyloid polypeptide (IAPP, amylin) is produced by processing of a precursor protein called...

  • Find the two other segments of the sequence among your classmates that will complete the protein....

    Find the two other segments of the sequence among your classmates that will complete the protein. For example if you have a middle segment you will need to find a beginning and an end segment. Write the entire linear order of amino acids in Part 2, Question l in your proforma, (using the single letter amino acid abbreviation). Start with the beginning segment, followed by the middle segment and lastly, the end segment. Indicate the amino (NH2) and carboxyl (COOH)...

  • In part A, yes you should reconstitute the full-length protein sequence from the fragments. However, you...

    In part A, yes you should reconstitute the full-length protein sequence from the fragments. However, you do not need to write out the amino acid sequence - you can just provide the order of the fragment numbers (from either set of fragments). For example (and this is not the answer), you could say: "Using the Pro-IAPP fragment set, starting from the N-terminus, the fragment order is '5-4-6-3-2-1' " and that would fully address the question. In part B, the hint...

  • THIS IS BIOCHEMISTRY A peptide has a low pI value. Which of the following amino acids...

    THIS IS BIOCHEMISTRY A peptide has a low pI value. Which of the following amino acids are likely to be present? Glycine Serine Valine Aspartic aci Arginine    The R-groups of which of the following pairs of amino acids could participate in the formation of salt bridge electrostatic interaction? Alanine and valine Valine and lysine Lysine and glutamate Serine and isoleucine Asparagine and glutamine Which of the following interactions does NOT contribute to stabilizing tertiary structure? Hydrophobic interactions Electrostatic interations...

ADVERTISEMENT
Free Homework Help App
Download From Google Play
Scan Your Homework
to Get Instant Free Answers
Need Online Homework Help?
Ask a Question
Get Answers For Free
Most questions answered within 3 hours.
ADVERTISEMENT
ADVERTISEMENT