Question

As a biochemist, you isolate and begin to study the biochemical properties of a peptide hormone...

As a biochemist, you isolate and begin to study the biochemical properties of a peptide hormone with the following sequence:

(Assume the residues are numbered 1 through 30, left to right. For example, the last residue would be named “T30”)

A D S E R N C Q L V I L L A W L P G V K V Q C A L L D R E T

(a) List all of the residues that could contribute a positive charge?

(b) List all of the residues that could contribute a negative charge?

(c) List all of the residues that can be connected by a disulfide bond?

(d) List all of the residues that absorb ultraviolet light?

0 0
Add a comment Improve this question Transcribed image text
Answer #1

Basic amino acids contribute to positive charge as it has NH2 group that can take up proton and become positive.

Acidic amino acids contribute to negative charge as it has COOH group and can loss proton and become negative.

Disulfide bond can only be formed by those amino acids that has sulfur in it.

Only aromatic acids absorb UV light.

a) A1, R5, K20, R28

b) D2, S3, E4, A14, D27, E29, T30

c) C7, C23

d) W15,

Add a comment
Know the answer?
Add Answer to:
As a biochemist, you isolate and begin to study the biochemical properties of a peptide hormone...
Your Answer:

Post as a guest

Your Name:

What's your source?

Earn Coins

Coins can be redeemed for fabulous gifts.

Not the answer you're looking for? Ask your own homework help question. Our experts will answer your question WITHIN MINUTES for Free.
Similar Homework Help Questions
  • Imagine that you have just isolated a peptide hormone with the following primary sequence: MLSCRLQEALAALSKIVLADLGCVTGAPSDPR (Assume...

    Imagine that you have just isolated a peptide hormone with the following primary sequence: MLSCRLQEALAALSKIVLADLGCVTGAPSDPR (Assume the protein is in solution at physiological pH, and remember to include the amino acids at each end of the chain. A charge may come from the R-group, the N-terminus, and/or the C-terminus. If a residue occurs more than once, include each one in your answer.) List the residues (individual amino acids) that contribute a positive charge: ​ List the residues that contribute a...

  • You have a peptide whose sequence is secretly known, that you want to analyze. The peptide...

    You have a peptide whose sequence is secretly known, that you want to analyze. The peptide sequence is D-M-K-T-L-A-R-S-M-E-I-D-Q You have three reagents that cleave polypeptides, CNBr, chymotrypsin, and trypsin into smaller peptides. If you could purify these peptides and sequence them by Edman, but only get four amino acids. 1) what end of the protein does the Edman reaction cleave residues from? n-terminus or c-terminus 2) what are all the Edman sequences (up to 4 amino acids) of the...

  • A chain GIVEQCCASVCSLYQLENYCN B chain FVNQHLCGSHLVEALYLVCGERGFFYTPKA Shown above is the amino acid sequence of the hormone...

    A chain GIVEQCCASVCSLYQLENYCN B chain FVNQHLCGSHLVEALYLVCGERGFFYTPKA Shown above is the amino acid sequence of the hormone insulin. This structure was determined by Frederick Sanger and his coworkers. Most of this work is described in a series of articles published in the Biochemical Journal from 1945 to 1955. When Sanger and colleagues began their work in 1945, it was known that insulin was a small protein consisting of two or four polypeptide chains linked by disulfide bonds. Sanger and his coworkers...

  • consider the small peptide Y-R-P-N a) draw the entire peptide, with charges you would expect on...

    consider the small peptide Y-R-P-N a) draw the entire peptide, with charges you would expect on it at pH 7.4. b) tabulate the charge on the molecule at every pH between 1 and 13 c) calculate the pI for the peptide d) what is the overall charge on the peptide at ph 1? ph 7.4? ph 13? e) do you expect this peptide to absorb at 280 nm? why or why not? f) Mark all the chiral centers in the...

  • 12. Below is a portion of the abstract of a journal article. It describes the isolation,...

    12. Below is a portion of the abstract of a journal article. It describes the isolation, purification, and determination of the peptide sequence as well as, the location of each of the disulfide bridges of an antibacterial peptide from the cowpea plant. Give brief and to the point answers to the questions based upon this information. (2 pts) FEBS Joumal 273 (2006) 3489-3497 2006 The Authors Journal compilation2006 FEBS Identification of a cowpea y-thionin with bactericidal activity Octávio L. Franco,...

  • Matching... Write the letter beside that which best describes the following.                     1. _____ b-mercaptoethanol a....

    Matching... Write the letter beside that which best describes the following.                     1. _____ b-mercaptoethanol a. recognizes LVPRGS and cleaves the R-G peptide bond 2. _____ chymotrypsin b. purification technique used to separate proteins on the basis of charge 3. _____ trypsin c. utilizes DNA manipulation to co-express functional protein attachment 4. _____ cyanogen bromide d. purification technique used to separate proteins on the basis of size 5. _____ sodium dodecylsulfate e. is an example of an amphipathic molecule used...

  • 1. Given the following peptide, which of the following statements is true? Question options: a) The...

    1. Given the following peptide, which of the following statements is true? Question options: a) The N-terminal residue is leucine. b)This peptide contains 4 amino acid residues. c) The peptide contains a total of 6 ionizable groups. d) The net charge of this peptide at pH 7 is +1 Locate any peptide bond along the backbone of the given peptide. e) The bond between the C (of the C=O) and the N (of the N-H) of a peptide bond has...

  • 1. What is the product is the product formed from the acid hydrolysis of a simple...

    1. What is the product is the product formed from the acid hydrolysis of a simple amide? a. acid & base b. aldehyde & alcohol c. acid & amine d. ester & alcohol e. amine & aldehyde B. . Insulin is a polypeptide hormone that contains two short polypeptide chains linked by two interstrand disulfide bonds. The most login he most logical order of events to perform in order to sequence this protein would be: The peptides are reduced with...

  • is the product formed from the acid hydrolysis of a simple amide? 1. What is the...

    is the product formed from the acid hydrolysis of a simple amide? 1. What is the product a. acid & base b. aldehyde & alcohol c. acid & amine d. ester & alcohol e. amine & aldehyde 2. Insulin Insulin is a polypeptide hormone that contains two short polypeptide chains linked by two interstrand disulfide bonds The most logical order of events to perform in order to sequence this protein would be: The peptides are reduced with mercaptoethanol. B. The...

  • C,D, and E i need help with. 17. The following peptide forms part of Human Hemoglobin...

    C,D, and E i need help with. 17. The following peptide forms part of Human Hemoglobin subunit gammaa Asp-Leu-Lys-Gly-Thr-Phe-Ala A) Which amino acids are likely to be on the side of peptid acids are likely to be on the side of peptide that faces the interior of the protein? Insert your answer leu, Gto.Pne, Ala B) Which are likely to be facing the aqueous environment? Insert your answer Asp, lys, Thr Draw the structure of the sequence at pH7.4. Using...

ADVERTISEMENT
Free Homework Help App
Download From Google Play
Scan Your Homework
to Get Instant Free Answers
Need Online Homework Help?
Ask a Question
Get Answers For Free
Most questions answered within 3 hours.
ADVERTISEMENT
ADVERTISEMENT