Question

As a scientist, you hypothesize that a particular sequence of amino acids leads to localization in...

As a scientist, you hypothesize that a particular sequence of amino acids leads to localization in the inner mitochondria membrane. How could you test this using a non-mitochondrial cytosolic protein? Include the following components in your answer.

Hypothesis: Sequence X leads to localization in the inner mitochondrial membrane

Experimental Control:

Experimental Protein:

Method (s):

Result/Analysis:

0 0
Add a comment Improve this question Transcribed image text
Answer #1

The mitochondrial signal sequence is a 10-70 amino acid long peptide sequence that is found at the N-terminus of the newly synthesized protein. It is an established sequence. So, we can simply check the alignment of the given sequence with the conserved sequence and determine whether given sequence can serve as the mitochondrial target sequence. It is an in silico approach.

Invitro approach:
Hypothesis: The given sequence can cause mitochondrial localization.
Experimental control: A cytosolic protein tagged with GFP or a cytosolic protein tagged with the mutant signal sequence and GFP
Experimental protein: A cytosolic protein tagged with the given peptide sequence and GFP.
Method: Transfect/transform both the control and experimental proteins into a host system and observe for their localization. A cytosolic protein with GFP tag is expected to be found in the cytosol. If the given peptide sequences confer localization to the mitochondria, we can observe the GFP signal in the mitochondria from the cytosolic protein+ signal peptide + GFP construct.
Results: If the peptide sequence confers localization to the mitochondria, we can find the GFP signal in the mitochondria.

Add a comment
Know the answer?
Add Answer to:
As a scientist, you hypothesize that a particular sequence of amino acids leads to localization in...
Your Answer:

Post as a guest

Your Name:

What's your source?

Earn Coins

Coins can be redeemed for fabulous gifts.

Not the answer you're looking for? Ask your own homework help question. Our experts will answer your question WITHIN MINUTES for Free.
Similar Homework Help Questions
  • G alpha z (Gaz) is a protein of 355 amino acids in length. It is synthesized...

    G alpha z (Gaz) is a protein of 355 amino acids in length. It is synthesized in the cytoplasm and has no signal sequence, nor a start-transfer sequence, nor a nuclear import sequence or patch. After its initial synthesis, Gaz is bound by another protein called a palmitoyltransferase, which covalently attaches a fatty acid called palmitate to a cysteine side chain near the N-terminus of Gaz. This lipid modification allows Gaz to associate with the inner face of the plasma...

  • Below, you can find a partial sequence of last 30 amino acids of a certain protein...

    Below, you can find a partial sequence of last 30 amino acids of a certain protein (amino acids, single-letter code). There are also mutated sequences of the same protein. Explain which mutations could have happened. (pay attention to the sequence length and the sequence itself) (25) Original                 GVLSEGEWQLVLHVWAKVEADVAGHGQDIL Mutant 1             GVLSEGEWQLVLHV Mutant 2             GVLSEGEWQLVHVWAKVEADVAGHGQDIL Mutant 3             GVLQHDAWQLVLHVWAKVEADVAGHGQDIL Mutant 4             GVLSEGEWQLVLHVWAKVEAWLWVMGHEVMLQ Mutant 5             GVLSEGEWQLVLHVWAKVEADVAGHGQDILWALWQAEVGQLIGH

  • The following is a portion of the amino acid sequence of human GLUT1 purified from red...

    The following is a portion of the amino acid sequence of human GLUT1 purified from red blood cells.  Glucose is also shown for your convenience. 147  151 161   171   181 vspt alrgalgtlh qlgivvqili aqvfgldsim gnkd A.  An internal 23 amino acid region of the sequence above is the 5th transmembrane domain of GLUT1.  The beginning of the sequence is an intracellular loop.  The end of the sequence is an extracellular loop.  Indicate where these regions might be in the sequence.  Explain how you derived at your hypothesis....

  • You hypothesize that a DNA sequence located 3.0 kb upstream of the promoter of a gene...

    You hypothesize that a DNA sequence located 3.0 kb upstream of the promoter of a gene you are studying contains an enhancer. To test your hypothesis, you use recombinant DNA techniques to insert a DNA fragment containing this DNA sequence into a plasmid also containing a “reporter gene.” Note:A reporter gene encodes for a protein that you can detect when expressed. For example, you could use the lacZ gene that encodes for the enzyme β-Galactosidase as a reporter gene. As...

  • 1) You have two human liver cells (A and B) and you hypothesize that the insulin...

    1) You have two human liver cells (A and B) and you hypothesize that the insulin receptor gene in Cell A has a mutation in exon 1 and Cell B contains the wild type sequence.  You extract genomic DNA from each of the cells.  Of the following, what would be the most efficient (quick, precise and relatively cheap) way to test your hypothesis. a. Isolate protein from both cells, purify the insulin receptor, and determine the amino acid content. b. Sequence the...

  • Imagine a biochemistry lab is testing out a new procedure to improve the synthesis of a...

    Imagine a biochemistry lab is testing out a new procedure to improve the synthesis of a dipeptide molecule made with the amino acids Valine and Threonine. The hypothesis is that acid as a catalyst will improve the condensation reaction between the amino acids and create a greater yield of a dipeptide (molecule formed with these two amino acids). The procedure compares the result of 10 samples using the common older procedure (A) to ten samples using the newer acid synthesis...

  • You are a scientist working for a lab attempting to develop an anti-obesity drug called glucono....

    You are a scientist working for a lab attempting to develop an anti-obesity drug called glucono. The idea is that glucono could be added to the diet to reduce glucose and calorie absorption; even though glucono would be absorbed, it would not be metabolized, and would be excreted by the kidney. The hypothesis is that glucono binds to the Na+/glucose transporter that is a part of secondary active transport of glucose. This cannot be easily studied in humans, so you...

  • can you just answer 1,3,4 then ? All of 20 hing Med ia 1 The incide...

    can you just answer 1,3,4 then ? All of 20 hing Med ia 1 The incide d together by chemical beads to form long chains, in the same way that ar e made of long chains of simple molecules Unlike carboidrates, however, protein molecules fold pinc h pes are for their higical function. The folded structure of a protein depends on the sequence of the amino acid building block that forms the polymer chain. A folded protein is shown on...

  • I only need answer to 4 4- Which is stronger - the bond between water molecules...

    I only need answer to 4 4- Which is stronger - the bond between water molecules or the bond between the two amino acids (formed from the dehydration synthesis above)? Explain why? (2pt) Imagine a biochemistry lab is testing out a new procedure to improve the synthesis of a dipeptide molecule made with the amino acids Valine and Threonine. The hypothesis is that acid as a catalyst will improve the condensation reaction between the amino acids and create a greater...

  • please help me type my introduction for my lab report. thank you!! INTRODUCTION In this section,...

    please help me type my introduction for my lab report. thank you!! INTRODUCTION In this section, you will introduce the experiment by explaining generally what you did and why you did it. This section usually starts with an examination of the literature through a library search to inform the reader about work already done on this topic. If you have never done a bibliographic database search for scientific journal articles, then you are not yet a biological sciences major (note:...

ADVERTISEMENT
Free Homework Help App
Download From Google Play
Scan Your Homework
to Get Instant Free Answers
Need Online Homework Help?
Ask a Question
Get Answers For Free
Most questions answered within 3 hours.
ADVERTISEMENT
ADVERTISEMENT