Question

Biochemistry amino acid question.Researchers discover a correlation between a disea

0 0
Add a comment Improve this question Transcribed image text
Answer #1

Aspartic acid is polar and acidic. It has COOH group. It donates H+ ions and forms carboxylate to be at physiological pH and has negative charge. When this amino acid - aspartic acid is substituted with glycine the structure of protein will get affected as the new amino acid glycine is small in size and has no side groups and is amphoteric.

B) Usually aspartate act as binding sites as they themselves are negatively charge and can bind to positive charges. So this role of being an active site may come to halt. While, other role can be the buffering action which this amino acid does .

Add a comment
Know the answer?
Add Answer to:
Biochemistry amino acid question. Researchers discover a correlation between a disease and the substitution of an...
Your Answer:

Post as a guest

Your Name:

What's your source?

Earn Coins

Coins can be redeemed for fabulous gifts.

Not the answer you're looking for? Ask your own homework help question. Our experts will answer your question WITHIN MINUTES for Free.
Similar Homework Help Questions
  • THIS IS BIOCHEMISTRY A peptide has a low pI value. Which of the following amino acids...

    THIS IS BIOCHEMISTRY A peptide has a low pI value. Which of the following amino acids are likely to be present? Glycine Serine Valine Aspartic aci Arginine    The R-groups of which of the following pairs of amino acids could participate in the formation of salt bridge electrostatic interaction? Alanine and valine Valine and lysine Lysine and glutamate Serine and isoleucine Asparagine and glutamine Which of the following interactions does NOT contribute to stabilizing tertiary structure? Hydrophobic interactions Electrostatic interations...

  • please answers fast and in detail. thank youuuuu it is biochemistry question not the chemistry. By...

    please answers fast and in detail. thank youuuuu it is biochemistry question not the chemistry. By mistake I put chemistry. please do it and send me answer as soon as possible, thank youuuu. Question #4 (10 points)-Mass spectroscopy Amino Acid Molecular Weight 89 174 133 146 75 146 115 137, 194 Alanine Arginine Aspartic acid Glutamic acid Glycine Lysine Proline Serine Tyrosine Valine 425, 1051 384 340 619 146 105 891 473 5301 2701 181 117 Mass/charge (here the charge...

  • Question 5 Bio206 Homework 6 Amino Acids and Proteins Organic Chemistry II Due May 6, 2017 1. Which amino acid is least likely to be found in a natural protein? CH20H NHz CHs IV 2. A pentapeptide has...

    Question 5 Bio206 Homework 6 Amino Acids and Proteins Organic Chemistry II Due May 6, 2017 1. Which amino acid is least likely to be found in a natural protein? CH20H NHz CHs IV 2. A pentapeptide has the molecular formula: Asp, Glu, His, Phe, Val. Partial hydrolysis of the pentapeptide gives: Val Asp, Glu His, Phe Val, and Asp Glu. What is the amino acid sequence of the pentapeptide? 3. When the pentapeptide below is heated first with 2,4-dinitrofluorobenzene...

  • A chain GIVEQCCASVCSLYQLENYCN B chain FVNQHLCGSHLVEALYLVCGERGFFYTPKA Shown above is the amino acid sequence of the hormone...

    A chain GIVEQCCASVCSLYQLENYCN B chain FVNQHLCGSHLVEALYLVCGERGFFYTPKA Shown above is the amino acid sequence of the hormone insulin. This structure was determined by Frederick Sanger and his coworkers. Most of this work is described in a series of articles published in the Biochemical Journal from 1945 to 1955. When Sanger and colleagues began their work in 1945, it was known that insulin was a small protein consisting of two or four polypeptide chains linked by disulfide bonds. Sanger and his coworkers...

  • Question #4 (10 points) - Mass spectroscopy Amino Acid Molecular Weight 89 174 133 146 137,...

    Question #4 (10 points) - Mass spectroscopy Amino Acid Molecular Weight 89 174 133 146 137, 194 Alanine Arginine Aspartic acid Glutamic acid Glycine Lysine Proline Serine Tyrosine Valine 105 384 340 Hidal 146 115 105 181 117 146 Mass/charge (here the charge is -1, so it's just mass) Above is shown a mass spectroscopy for a peptide 5 amino acids long derived from a soluble protein. This 5 amino acid peptide represents a hydrophilic surface part of the protein...

  • Hello, I have a Biochemistry question. I am currently learning about proteins (their structures, folding etc)...

    Hello, I have a Biochemistry question. I am currently learning about proteins (their structures, folding etc) and enzymes (competitive and noncompetitive inhibition etc)... Thanks so much! Discussion Board Objectives: Construct a problem based on the course content that lends itself to being critically evaluated by your peers. Respond critically and constructively to 2 peer posts using current course content, foundational knowledge, and information from a peer-reviewed source (textbook, journal article, figure etc.). Instructions: This discussion board has two parts. Post...

  • The genetic code is "redundant" because: Question 1 options: Each amino acid is specified by only...

    The genetic code is "redundant" because: Question 1 options: Each amino acid is specified by only a single codon Most amino acids are specified by multiple codons Codons are groups of four consecutive DNA bases Each codon can specify multiple amino acids Question 2 (1 point) A mutation in the DNA may not result in change in protein function because: Question 2 options: Many different amino acids share similar chemical properties, so can substitute for one another without altering function...

  • The genetic code is "redundant" because: Question 1 options: Each amino acid is specified by only...

    The genetic code is "redundant" because: Question 1 options: Each amino acid is specified by only a single codon Most amino acids are specified by multiple codons Codons are groups of four consecutive DNA bases Each codon can specify multiple amino acids Question 2 (1 point) A mutation in the DNA may not result in change in protein function because: Question 2 options: Many different amino acids share similar chemical properties, so can substitute for one another without altering function...

  • Use of Modern Molecular Techniques to Determine the Synthetic Pathway of a Novel Amino Acid. Most...

    Use of Modern Molecular Techniques to Determine the Synthetic Pathway of a Novel Amino Acid. Most of the biosynthetic pathways described in our book were determined before the development of recombinant DNA technology and genomics, so the techniques were quite different from those that researchers would use today. Through this question, you will explore an example of the use of modern molecular techniques to investigate the pathway of synthesis of a novel amino acid, (2S)-4- amino-2-hydroxybutyrate (AHBA). AHBA is a...

ADVERTISEMENT
Free Homework Help App
Download From Google Play
Scan Your Homework
to Get Instant Free Answers
Need Online Homework Help?
Ask a Question
Get Answers For Free
Most questions answered within 3 hours.
ADVERTISEMENT
ADVERTISEMENT