Homework Answers
Add Answer to:
11/. Explain how this synthesis of amino acids, starting with natural proline, works. Explain the stereoselectivity...
10 and 11 10/ in the following two-steps thermally initiated transformation, what is the structure of...
10 and 11
10/ in the following two-steps thermally initiated transformation, what is the structure of the intermediate that is formed? c., có con 11/. Explain how this synthesis of amino acids, starting with natural proline, works. Explain the stereoselectivity of each step after the first. HOR - н A NH HẠO HR COH * HOC NH2 HLR
Explain why synthesis of a dipeptide from two individual amino acids is energetically unfavorable. Explain how...
Explain why synthesis of a dipeptide from two individual amino acids is energetically unfavorable. Explain how this unfavorable synthesis may occur in biological systems.
please explain your answers 11. Indicate whether the pairs of compounds shown below are enantiomers, diastereomers,...
please explain your answers
11. Indicate whether the pairs of compounds shown below are enantiomers, diastereomers, structural (constitutional) isomers, the same compound, or different compounds which are not isomers. (0.25 pts ea = 1 pt) vs. нон Но н. он он HOCHS HT CH3 C vs. Broh H₃CH НОСН2СНО нон нон H How HOCH CHO н JONH2 NH2 HOC CH2SH HSCHE CO2H
how to draw a phylogeny tree based on the information of amino acids in table 2...
how to draw a phylogeny tree
based on the information of amino acids in table 2 ?with
explanation please
by using the amino acid differences between the species in the
table, for example it can be seen that chimpanzees are similar to
humans .....
. S . FEE Table 2 Mitochondrial cytochrome oxidase subunit II (CO II) amino acids (aa) 1-30 of the 227 total aa for the primate species Lemur catta, Paio ursinus, Pan troglodytes, Hylobates lar, Homo sapiens,...
how do you solve for these? HOW DO YOU SOLVE THESE QUESTIONS STEP BY STEP MECHANISMS...
how do you solve for these?
HOW
DO YOU SOLVE THESE QUESTIONS STEP BY STEP MECHANISMS
3. Show a mechanism for the following (Grant Challenge). Hint at end with * if you need it. - this is for the people that want a big challenge and who are already very comfortable with mechanisms. 3. Na2CO3, H, 0 0 4. Propose a synthesis for the following, starting from methanolas your only carbon-based starting material. ool logo Me 5. Classify the following...
The scheme below shows the synthesis of an antihypertensitive agent (drug used to treat high blood...
The scheme below shows the synthesis of an antihypertensitive agent (drug used to treat high blood pressure). Answer the questions that follows. a Br 1 Br CI с CO Me + Meo H2NCO Me (Question 3) B OME CN CN CN CN 6 2 3 4 5 CO Me CO Me Buz SnNz d Final product (9) (1) KOH, heat (2) H+ work up partial hydrolysis (Question 4) CAH, CAH, CN 7 NH NEN 8 Question 1 Select the best...
Questions 11-15: Gene structure/Splicing problem. "Protein X" consists of a total of 431 amino acids. Your...
Questions 11-15: Gene structure/Splicing problem. "Protein X" consists of a total of 431 amino acids. Your colleague, techniques) the a biochemist, has purified the protein and determined (via complicated and messy chemical sequence of the first 37 amino acids in the protein, which she has reported to you as follows: HN- MSNITVDDELNLSREQQGFAEDDFIVIKEERETSLSP . nwhile, you have isolated a genomic clone of the gene that codes for protein X, and determined the DNA equence of the first 227 bases from the...
Synthesis using Carbonyla-Substitution Chemistry Preamble This experiment involves the synthesis of target molecules using a-substitution chemistry....
Synthesis using Carbonyla-Substitution Chemistry Preamble This experiment involves the synthesis of target molecules using a-substitution chemistry. You are assigned two target molecules, one of which is best synthesized by an alkylation approach, while the other is best synthesized by an addition or condensation approach. My two target molecules are number 2 and number 12 in the last page. You must do the following: 1. Perform a retrosynthetic analysis on the two target molecules assigned to you. In each case the...
Page 1 Synthesis using Carbonyl O-Substitution Chemistry Preamble This experiment involves the synthesis of target molecules...
Page 1 Synthesis using Carbonyl O-Substitution Chemistry Preamble This experiment involves the synthesis of target molecules using a-substitution chemistry. You are assigned two target molecules, one of which is best synthesized by an alkylation approach, while the other is best synthesized by an addition or condensation approach. You must do the following: 1. Perform a retrosynthetic analysis on the two target molecules assigned to you. In each case the organic starting material (what you have to work backwards toward) depends...
11 Department of Biological Sciences BIOCHEMISTRY Test 2.2018 H. Nucleic Acid, Sequencing of DNA: Amino Acids...
11 Department of Biological Sciences BIOCHEMISTRY Test 2.2018 H. Nucleic Acid, Sequencing of DNA: Amino Acids Hydrolysis of salt Laboratory buffers, Polyprotie acids QUESTIONS 1. The DNA strand complementary to the strand 3-GTAGCGTAT-Y' would have the sequence a SLTACOCATAT-3 b.3.CATOXICATA-S c. 3-ATGCGTATA-S" ATATGCGTAS 2. When cytosine is treated with bisulfite, the amino group is replaced with a carbonyl group. Identify the resulting base a. adenine b. guanine c uracil d. thyminee. typoxanthine 3. How many amino acids would be in...
10 and 11
10/ in the following two-steps thermally initiated transformation, what is the structure of the intermediate that is formed? c., có con 11/. Explain how this synthesis of amino acids, starting with natural proline, works. Explain the stereoselectivity of each step after the first. HOR - н A NH HẠO HR COH * HOC NH2 HLR
please explain your answers
11. Indicate whether the pairs of compounds shown below are enantiomers, diastereomers, structural (constitutional) isomers, the same compound, or different compounds which are not isomers. (0.25 pts ea = 1 pt) vs. нон Но н. он он HOCHS HT CH3 C vs. Broh H₃CH НОСН2СНО нон нон H How HOCH CHO н JONH2 NH2 HOC CH2SH HSCHE CO2H
how to draw a phylogeny tree
based on the information of amino acids in table 2 ?with
explanation please
by using the amino acid differences between the species in the
table, for example it can be seen that chimpanzees are similar to
humans .....
. S . FEE Table 2 Mitochondrial cytochrome oxidase subunit II (CO II) amino acids (aa) 1-30 of the 227 total aa for the primate species Lemur catta, Paio ursinus, Pan troglodytes, Hylobates lar, Homo sapiens,...
how do you solve for these?
HOW
DO YOU SOLVE THESE QUESTIONS STEP BY STEP MECHANISMS
3. Show a mechanism for the following (Grant Challenge). Hint at end with * if you need it. - this is for the people that want a big challenge and who are already very comfortable with mechanisms. 3. Na2CO3, H, 0 0 4. Propose a synthesis for the following, starting from methanolas your only carbon-based starting material. ool logo Me 5. Classify the following...
The scheme below shows the synthesis of an antihypertensitive agent (drug used to treat high blood pressure). Answer the questions that follows. a Br 1 Br CI с CO Me + Meo H2NCO Me (Question 3) B OME CN CN CN CN 6 2 3 4 5 CO Me CO Me Buz SnNz d Final product (9) (1) KOH, heat (2) H+ work up partial hydrolysis (Question 4) CAH, CAH, CN 7 NH NEN 8 Question 1 Select the best...
Questions 11-15: Gene structure/Splicing problem. "Protein X" consists of a total of 431 amino acids. Your colleague, techniques) the a biochemist, has purified the protein and determined (via complicated and messy chemical sequence of the first 37 amino acids in the protein, which she has reported to you as follows: HN- MSNITVDDELNLSREQQGFAEDDFIVIKEERETSLSP . nwhile, you have isolated a genomic clone of the gene that codes for protein X, and determined the DNA equence of the first 227 bases from the...
Synthesis using Carbonyla-Substitution Chemistry Preamble This experiment involves the synthesis of target molecules using a-substitution chemistry. You are assigned two target molecules, one of which is best synthesized by an alkylation approach, while the other is best synthesized by an addition or condensation approach. My two target molecules are number 2 and number 12 in the last page. You must do the following: 1. Perform a retrosynthetic analysis on the two target molecules assigned to you. In each case the...
Page 1 Synthesis using Carbonyl O-Substitution Chemistry Preamble This experiment involves the synthesis of target molecules using a-substitution chemistry. You are assigned two target molecules, one of which is best synthesized by an alkylation approach, while the other is best synthesized by an addition or condensation approach. You must do the following: 1. Perform a retrosynthetic analysis on the two target molecules assigned to you. In each case the organic starting material (what you have to work backwards toward) depends...
11 Department of Biological Sciences BIOCHEMISTRY Test 2.2018 H. Nucleic Acid, Sequencing of DNA: Amino Acids Hydrolysis of salt Laboratory buffers, Polyprotie acids QUESTIONS 1. The DNA strand complementary to the strand 3-GTAGCGTAT-Y' would have the sequence a SLTACOCATAT-3 b.3.CATOXICATA-S c. 3-ATGCGTATA-S" ATATGCGTAS 2. When cytosine is treated with bisulfite, the amino group is replaced with a carbonyl group. Identify the resulting base a. adenine b. guanine c uracil d. thyminee. typoxanthine 3. How many amino acids would be in...
Most questions answered within 3 hours.
-
Where is the error in this code sequence?
String s1 = "Hello";
String s2 = "ello";...
asked 11 months ago -
Financial data for Joel de Paris, Inc., for last year
follow:
Joel de Paris, Inc.
Balance...
asked 11 months ago -
Consider this reaction:
Al2(SO4)3 (aq)+ BaCl3
(aq) Al2Cl6 (aq)- +
3BaSO4(s) . What is the...
asked 11 months ago -
Suppose that Savneet is considering increasing her
recent random sample from 20 car rentals to 40...
asked 11 months ago -
Trucks arrive at an unloading terminal at an average rate of 120
per hour.
Trucks arrive...
asked 11 months ago -
Why are methanol and ethanol completely soluble in water while
octanol is not very little soluble....
asked 11 months ago -
A facilities manager at a university reads in a research report
that the mean amount of...
asked 11 months ago -
When the CuSO4 is rehydrated by adding water to the anhydrous
compound, is this an endothermic...
asked 11 months ago -
A ray of sunlight is passing from diamond into crown glass; the
angle of incidence is...
asked 11 months ago -
A block of mass 0.249 kg is placed on top of a light, vertical
spring of...
asked 11 months ago -
how do the kidneys compensate in the presences of acidosis
a) trigger hyperventilate
b) reserve acid...
asked 11 months ago -
Question 501 pts
The rental rate of capital to the firm increases. Which of the
following...
asked 11 months ago