Question

Questions 11-15: Gene structure/Splicing problem. Protein X consists of a total of 431 amino acids. Your colleague, techniques) the a biochemist, has purified the protein and determined (via complicated and messy chemical sequence of the first 37 amino acids in the protein, which she has reported to you as follows: HN- MSNITVDDELNLSREQQGFAEDDFIVIKEERETSLSP . nwhile, you have isolated a genomic clone of the gene that codes for protein X, and determined the DNA equence of the first 227 bases from the 5end of the gene/transcription unit, as shown below (only the coding/non-template strand is indicated). You know that the ORF begins within this sequence (i.e., that it includes the actual start codon), and comparisons with a cDNA clone have indicated that there is a single intron contained within this region (there also others further downstream, but those are not relevant h 60 5-GTCTTCCACATCGGCCTCACCCATGAGCAACATAACCGTGGATGACGAGCTCAACTTAAG 61 120 CAGAGAACAGCAAGGTGAGTTCAAGTTCAAAACTATATGAATATACTAGCCGTGCTGATT 121 180 GTCTCTTCCTTCCTTTTTCAGGCTTTGCTGAAGACGATTTCATAGTGATCAAGGAGGAGC 181 227 GCGAGACAAGTCTCTCCCCCATAAGGACTACGCACCCGCAGTTTATA.... 3 Questions 11-13: Based on the information presented above (and relevant info from your textbook, including the genetic code and the splice site consensus sequences), you should be able to: 1) relate the amino acid sequence to the DNA sequence, and thereby 2) unambiguously identify the intron vs. exon sequences in the genomic DNA. After doing so, answer the following: 11) How large is the intron (give the exact length/number of bases)? 12) What is the number of the FIRST base in the intron (i.e., the base at/adjacent to the 5 splice site)? (Give the exact number, using the numbering system indicated on the figure above). 13) What is the number of the branchpoint nucleotide? (i.e., the invariant A which gets linked to the 5 end of the intron in the lariat when the RNA is spliced.) Questions 14-15: A transition mutation that affects the FIRST base in the intron (i.e., as indicated in problem 12) prevents splicing. Determining the amino acid sequence that would result if this unspliced mutant mRNA is translated, and then answer the following: 14) How many amino acids (in total) are present in the mutant polypeptide? 15) What is the last (C-terminal) amino acid in the mutant polypeptide?
0 0
Add a comment Improve this question Transcribed image text
Answer #1

Answer11: The intron is 67 bases long and its 5' splice site is AG...GTGAGT while the 3' splice site is CAG..G

Answer 12: the first base of intron is located at position 75 of the given seuqence.

Answer 13: The branch point is located at position 118 in the given sequence.

Answer 14; The mutation will change the GTG to ATG. So no splicing will occur and the number of amino acids can be calculated by counting the number of additional codons.

Add a comment
Know the answer?
Add Answer to:
Questions 11-15: Gene structure/Splicing problem. "Protein X" consists of a total of 431 amino acids. Your...
Your Answer:

Post as a guest

Your Name:

What's your source?

Earn Coins

Coins can be redeemed for fabulous gifts.

Not the answer you're looking for? Ask your own homework help question. Our experts will answer your question WITHIN MINUTES for Free.
Similar Homework Help Questions
  • Below is the genomic DNA of gene X, a 3 exon gene that encodes a 131 amino acid single pass trans...

    why is E the answer Below is the genomic DNA of gene X, a 3 exon gene that encodes a 131 amino acid single pass transmembrane protein. Shown are the transcriptional start site, splice donor, acceptor and branch sites and translational start and stop codons. Transcriptional start EXON 1 INTRON 1 EXON 2 INTRON 2 EXON 3 Spfice Donor Splice Acceptor Polyadenylation signal Branch point 17. Treatment with ethidium bromide, an intercalating agent, caused DNA polymerase to add an extra...

  • Genes in eukaryotes are often organized into exons and intrans, which require splicing to produce an...

    Genes in eukaryotes are often organized into exons and intrans, which require splicing to produce an mRNA that can be translated. The gene organization is the order of the DNA segments that comprise the gene starting with the promoter, the first exon, the first intron, the second exon, and so on. The interspersed intrans can make gene identification difficult in eukaryotesparticularly in higher eukaryotes with many introns and alternative spliced mRNAs. Prediction of many genes and their organization has been...

  • QUESTION 7 If the MC1R protein is 317 amino acids long why are there 954 base...

    QUESTION 7 If the MC1R protein is 317 amino acids long why are there 954 base pairs in the coding region of the gene? Each amino acid has a mRNA codon and DNA triplet consisting of a three-base sequence. (317 x 3951 plus a stop codon (951-3-954) to signal the end of translation) Because there are 317 proteins in the MC1R code. mutant proteins always have 954 base pairs. Each amino acid has a mRNA codon and DNA triplet consisting...

  • 11. What is the first amino ackd of any initial protein that is A. Valine C....

    11. What is the first amino ackd of any initial protein that is A. Valine C. Lysine D. Tryptophan E. Methionine 12. Choose all that apply. Polymerase Chain Reaction (PCR) can be used to A Create a DNA profile of suspects, victims, and criminals during crime scene investigations B. Duplicate pieces C. Help determine paternity D. Stimulate cell division E. Stimulate gene expression of DNA into many copies using a special form of DNA polymerase 13. What occurs during transcription?...

  • Genetics Worksheet Week 3: Gene Regulation and Epigenetics 1. Duchenne muscular dystrophy is caused by a mutation in a gene that is 2.5 million nucleotides in length and encodes a protein called dyst...

    Genetics Worksheet Week 3: Gene Regulation and Epigenetics 1. Duchenne muscular dystrophy is caused by a mutation in a gene that is 2.5 million nucleotides in length and encodes a protein called dystrophin. The dystrophin protein itself is 3684 amino acids in length. Calculate below the approximate size of the mRNA that encodes dystrophin. Approximately what percentage of the gene that encodes dystrophin is intron sequence? The human genome encodes a much greater variety and number of proteins than the...

  • 10 DN A and RNA: Structure and Function Name Lab section may collect These end-ofesercise questions...

    10 DN A and RNA: Structure and Function Name Lab section may collect These end-ofesercise questions so, pleare Aill in your name and kob secin End-of-Exercise Questions Directions: Use the complete codon dictionary (table 10.2) to answer these questions 1. Use the base equence for mRNA to complete the columns on the following table (table 10.4). (Use the mRNA Rememsn the table. Do not use the mRNA hase pair sequence from the exercise you just completed.) sequence shown in the...

  • Dystrophin is a protein that forms part of a vital protein complex that connects the cytoskeleton...

    Dystrophin is a protein that forms part of a vital protein complex that connects the cytoskeleton of a muscle fiber cell to the extracellular matrix. This connection strengthens and shapes the muscle fibers. Dystrophin is coded by the DMD gene. This is one of the longest human genes known, covering 2,300,000 base pairs (0.08% of the human genome) It is located in chromosome 21. The immature mRNA is 2,100,000 bases long and takes 16 hours to transcribe. It contains 79...

  • DNA, Genes and Protein Synthesis Activity 13: Protein Synthesis is the process by which cells produce (synthesize) proteins. An overview of the process is shown in model 2 (below). Gone 2...

    DNA, Genes and Protein Synthesis Activity 13: Protein Synthesis is the process by which cells produce (synthesize) proteins. An overview of the process is shown in model 2 (below). Gone 2 Gene 1 Gene 3 DNA strand3 TRANSLATION Protein Trp Gly Model 2 ACTIVITY and QUESTIONS 1. Based on the information you can gather from model 1 complete the following sentences: a. The nucleotide Adenine (A) always pairs with the nucleotide b. The nucleotide Guanine (G) always pairs with the...

  • onaformation from a ee is used in the synthesisof 17 functional gene product. A) Geno B)...

    onaformation from a ee is used in the synthesisof 17 functional gene product. A) Geno B) Gene regulation C) Epigenetics D) Imprinting E) Chromatin remodeling 18. A histone code is the: A) B) nucleotide sequence of an individual histone protein's gene. pattern of chemical modification of the DNA wrapped around an individual histone. C) D) E) pattern of chemical modification of the histone tails. number of amino acids in an individual histone that are methylated None of the other answer...

  • 22. What are the roles of Dicer and RISC in the function of miRNAs? Dicer RISC...

    22. What are the roles of Dicer and RISC in the function of miRNAs? Dicer RISC 23. Describe the concepts of primary, secondary, tertiary and quaternary protein structure 24. Here is a short sequence of codons. AUG CAU UGU UUU Write out the amino acids this sequence of codons encodes. Now add an insertion mutation of your choosing in the first codon and write out the new mutant sequence. What are the first four amino acids encoded by this mutant...

ADVERTISEMENT
Free Homework Help App
Download From Google Play
Scan Your Homework
to Get Instant Free Answers
Need Online Homework Help?
Ask a Question
Get Answers For Free
Most questions answered within 3 hours.
ADVERTISEMENT
ADVERTISEMENT