Question

Below is the genomic DNA of gene X, a 3 exon gene that encodes a 131 amino acid single pass transmembrane protein. Shown are

why is E the answer

0 0
Add a comment Improve this question Transcribed image text
Answer #1

E is answer because, when ethidium Bromide is used it causes mutation. Growth in the presence of ethidium  RNA and protein contents were relatively unaffected but the pattern of protein synthesis was disturbed by ethidium Bromide. Ethidium Bromide produces a remarkable inhibition of the incorporation of labelled purine into polynucleotide while nucleic acid synthesis continued at on only slightly slower rate.

Add a comment
Know the answer?
Add Answer to:
Below is the genomic DNA of gene X, a 3 exon gene that encodes a 131 amino acid single pass trans...
Your Answer:

Post as a guest

Your Name:

What's your source?

Earn Coins

Coins can be redeemed for fabulous gifts.

Not the answer you're looking for? Ask your own homework help question. Our experts will answer your question WITHIN MINUTES for Free.
Similar Homework Help Questions
  • Below is a schematic of gene Hemoglobin beta subunit (HBS), which encodes protein HBS. The promoter...

    Below is a schematic of gene Hemoglobin beta subunit (HBS), which encodes protein HBS. The promoter region is indicated by the dotted box. Transcriptions begins immediately following the promoter. The mature mRNA produced by this gene would be approximately how many nucleotides long? A) 100 B) 200 C) 3000 D) 5000 E) 7000 1. Below is a schematic of gene Hemoglobin beta subunit (HBS), which encodes protein HBS. The promoter region is indicated by the dotted box. Transcription begins immediately...

  • 3of 3 9. The figure below represents the primary transcript of a gene that contains four exons (A, B, C, D) and two introns. The dark block in exon B indicates the position of an additional stop...

    3of 3 9. The figure below represents the primary transcript of a gene that contains four exons (A, B, C, D) and two introns. The dark block in exon B indicates the position of an additional stop codon; the normal start and stop codons for translation are present in exons A and D respectively. The two arrows indicate alternative 3' splice sites for the first intron Pre-mRNA 5'I 3' intron intron Give a schematic representation of the mature mRNAs that...

  • Questions 11-15: Gene structure/Splicing problem. "Protein X" consists of a total of 431 amino acids. Your...

    Questions 11-15: Gene structure/Splicing problem. "Protein X" consists of a total of 431 amino acids. Your colleague, techniques) the a biochemist, has purified the protein and determined (via complicated and messy chemical sequence of the first 37 amino acids in the protein, which she has reported to you as follows: HN- MSNITVDDELNLSREQQGFAEDDFIVIKEERETSLSP . nwhile, you have isolated a genomic clone of the gene that codes for protein X, and determined the DNA equence of the first 227 bases from the...

  • B. (10pts) Gene expression can be regulated in many ways. In the gene below, each letter...

    B. (10pts) Gene expression can be regulated in many ways. In the gene below, each letter represents a different mutation. Indicate which mutation would: (Use each letter only once.) trigger non-sense mediated decay increase transcript stability result in aberrant splicing reduce mRNA expression levels alter ADAR RNA editing promoter D — transcribed region intron A intron E exon- transcription factor binding sites exon spliced mRNA T 5'UTR CDS 3'UTR start codon stop codon C. (8pts) UAU encodes the amino acid...

  • I. Use the DNA sequence below, which encodes a prokaryotic gene to answer the following questions....

    I. Use the DNA sequence below, which encodes a prokaryotic gene to answer the following questions. 11 21 31 41 51 71 81 61 91 CGTAATTGAG GAGGTAGTTG ACGTATGAAT AGTTAACGTA CGGGGGGGAA 101 111 121 131 141 ACCCCCCCTT TTTTTTTTTC GAGCAATAAA AGGGTTACAG ATTGCATGCT a) Write down the corresponding sequences, find them in the sequence above and label them: -35 Consensus sequence: _(label as -35) -10 Consensus sequence (Pribnow box): _ __ (label as Pribnow) Shine-Dalgarno sequence in corresponding mRNA: __ (label as SD)...

  • The following is a fragment of double-stranded DNA. It encodes a hypothetical 6 amino acid protein...

    The following is a fragment of double-stranded DNA. It encodes a hypothetical 6 amino acid protein and includes the start (initiator) codon, a small amount of 5' UTR, and a small amount of 3' UTR. TTGGCAATGTGATCCCTTGTGCGGTACCACT AACCGTTACACTAGGGAACACGCCATGGTGA The bottom strand is the template, and the RNA polymerase moves along the bottom (template) strand from RIGHT TO LEFT. a) Determine the orientation of the DNA template. The template strand is copied below. (Enter either 5' or 3' in the box below,...

  • Genetics Worksheet Week 3: Gene Regulation and Epigenetics 1. Duchenne muscular dystrophy is caused by a mutation in a gene that is 2.5 million nucleotides in length and encodes a protein called dyst...

    Genetics Worksheet Week 3: Gene Regulation and Epigenetics 1. Duchenne muscular dystrophy is caused by a mutation in a gene that is 2.5 million nucleotides in length and encodes a protein called dystrophin. The dystrophin protein itself is 3684 amino acids in length. Calculate below the approximate size of the mRNA that encodes dystrophin. Approximately what percentage of the gene that encodes dystrophin is intron sequence? The human genome encodes a much greater variety and number of proteins than the...

  • 100 300 400 200 A>G 800 500 AGGUA 600 exon 1 Hexon 2 exon 3 700...

    100 300 400 200 A>G 800 500 AGGUA 600 exon 1 Hexon 2 exon 3 700 exon 4 CAG UGA AUG UAA AAAAA Lane: 1 2 3 Lane: 1 2 3 4 5 4 5 approx. size (bp) -900 approx. size (Da) -12,000 -11,000 -800 -700 - 10,000 -600 -9000 -500 -8000 -7000 -400 -300 -6000 Northern Blot Western Blot (fig56) At the top of the figure above is a gene diagram for a hypothetical gene, noting the length of...

  • The following genomic DNA sequence comes from the first exon of a human gene and contains...

    The following genomic DNA sequence comes from the first exon of a human gene and contains the 3'-end of the 5'-untranslated region and the start of a long open reading frame that codes for 200 amino acids (a.k.a. coding sequence). Note: There are no introns in this short portion and only one strand of the genomic DNA is shown. Which of the following answers lists the first three amino acids of the translated protein correctly? Seconed Position tyr ser leu...

  • 21. The initiation of transcription of a gene occurs DNA when RNA polymerase binds to the...

    21. The initiation of transcription of a gene occurs DNA when RNA polymerase binds to the of the gene b. start codon c. exon 1 d. intron 1 e. splice site 22. Phosphodiester linkages are present in a. DNA b. mRNA c. tRNA d a and b e. all of the above 23. The 5' cap and poly A tail are added to a. pre-mRNA in the cytoplasm b. help with pre-mRNA splicing. c. protect mRNA d. assist in posttranslation...

ADVERTISEMENT
Free Homework Help App
Download From Google Play
Scan Your Homework
to Get Instant Free Answers
Need Online Homework Help?
Ask a Question
Get Answers For Free
Most questions answered within 3 hours.
ADVERTISEMENT
ADVERTISEMENT