Question

B. (10pts) Gene expression can be regulated in many ways. In the gene below, each letter represents a different mutation. Ind

0 0
Add a comment Improve this question Transcribed image text
Answer #1

1-A nonscence mediated decay causes degradation of transcript having premature stop codon. Hence The mutation in B region would cause the. occurence. of premature stop codon and will. lead to nonscence mediated. decay.

2- increased transcript stability can be because of themutation in C. region that codes for 3 prime region as, 3 prime regions contains regulatoru regions that post trancriptionaly maintain the stability of RNA.

3- Result in aberant splicing- Spilicing depends mostly on Exon-Intron junction sequences. Hence mutation in E region would affcet the spilcing.

4- Reduce in mRNA expression level- Mutation. in promoter region i.e D can cause reduction in Transcript as, it allows binding of essential tarsncription factor.mutation in the transcription factor binding sequenced may lead to reduced transcript level.

5- alter ADAR editing- ADAR is the Site-directed RNA editing. (A) should be the region that support Site-directed RNA editing, where it converts adenosine to (I) and can cause altered transcription.

UAU codes for tyrosine- a conservative chnage is the one which does not chnage the property of the amino acid. like tyrosine isa aromatic amino acid and phenyalanine as well so a UAU- UUU can cause a conservative chnage.

silent mutation is caused when a chnage in a codon codes for the same amino acid here a UAU ti UAC will cause a silent. mutation.

A non scence mutation causes a premature stop codon in the transcript so, a converstion of UAU to UAA(stop codon) will cause a nonscence muttaion.

a non-conservative change mutation is such that a codon change causes a different protein formation. i.e UAU codes for tyrosine but a chnage to UCU will chnage it to serine witha entirely different polar uncharged R group.

Add a comment
Know the answer?
Add Answer to:
B. (10pts) Gene expression can be regulated in many ways. In the gene below, each letter...
Your Answer:

Post as a guest

Your Name:

What's your source?

Earn Coins

Coins can be redeemed for fabulous gifts.

Not the answer you're looking for? Ask your own homework help question. Our experts will answer your question WITHIN MINUTES for Free.
Similar Homework Help Questions
  • Can someone please help with these two questions? Thank you. 4. Here is an RNA transcript...

    Can someone please help with these two questions? Thank you. 4. Here is an RNA transcript freshly transcribed from a gene. It is immature, meaning that it has not been processed yet into a mature mRNA. a) If you could zoom in on this molecule, what two things would you observe at the molecular level that would indicate to you that it is RNA and not DNA? b) Which end of the molecule was the last bit to be transcribed,...

  • 3of 3 9. The figure below represents the primary transcript of a gene that contains four exons (A, B, C, D) and two introns. The dark block in exon B indicates the position of an additional stop...

    3of 3 9. The figure below represents the primary transcript of a gene that contains four exons (A, B, C, D) and two introns. The dark block in exon B indicates the position of an additional stop codon; the normal start and stop codons for translation are present in exons A and D respectively. The two arrows indicate alternative 3' splice sites for the first intron Pre-mRNA 5'I 3' intron intron Give a schematic representation of the mature mRNAs that...

  • please Answer part B. Thanks. You are investigating an autosomal recessive cencition in an extended family....

    please Answer part B. Thanks. You are investigating an autosomal recessive cencition in an extended family. The gene responsible for the concition is known, but the specific allele in the family under study is uncharacterized Part A As part of your research, you examine mRNA expression for the parents, their two unafTected children, and their affected chid with a Northern blot using a ful-length cDNA probe Your results, shown here, are as folows: . Both parents have low, but detectable,...

  • 4. In future lectures we will describe a technique known as Northern blotting that can be...

    4. In future lectures we will describe a technique known as Northern blotting that can be used to detect RNA transcribed from a particular gene. Briefly, in this method a specific RNA is detected using a short segment of cloned DNA as a probe. The DNA probe, which is radioactive, is complementary to the RNA that the researcher wishes to detect. After the radioactive probe DNA basepairs to the RNA, the RNA is visualized as a dark (radioactive) band on...

  • QUESTION 6 Assume you are studying a protein-coding gene, ACEX, which includes 4 exons as illustrated...

    QUESTION 6 Assume you are studying a protein-coding gene, ACEX, which includes 4 exons as illustrated in the gene map below. The 5' UTR and 3' UTR segments are each 25 bp long. Exons 1 thru 4 are 100, 200, 300, 400 bp long, respectively. Each intron is 200 bp each. The locations of the relevant EcoRI sites within the ACEX locus are indicated, but the location of other restriction enzyme sites (like BamHI) are not shown." EcoRI probe EcoRI...

  • Questions 11-15: Gene structure/Splicing problem. "Protein X" consists of a total of 431 amino acids. Your...

    Questions 11-15: Gene structure/Splicing problem. "Protein X" consists of a total of 431 amino acids. Your colleague, techniques) the a biochemist, has purified the protein and determined (via complicated and messy chemical sequence of the first 37 amino acids in the protein, which she has reported to you as follows: HN- MSNITVDDELNLSREQQGFAEDDFIVIKEERETSLSP . nwhile, you have isolated a genomic clone of the gene that codes for protein X, and determined the DNA equence of the first 227 bases from the...

  • can you answer those 3 questions Ipuints Save an You have developed a potential new antidepressant...

    can you answer those 3 questions Ipuints Save an You have developed a potential new antidepressant drug called Euphoria. The structure is novel and is tested using the Ames test for mutagenicity. The following results are obtained: Sample Number of his+ revertant colonies distilled water distilled water + rat liver enzymes antidepressant antidepressant + rat liver enzymes What conclusion is most consistent with these data? the drug and its conversion products are not mutagenic. rat liver enzymes are mutagenic. the...

ADVERTISEMENT
Free Homework Help App
Download From Google Play
Scan Your Homework
to Get Instant Free Answers
Need Online Homework Help?
Ask a Question
Get Answers For Free
Most questions answered within 3 hours.
ADVERTISEMENT
ADVERTISEMENT