Question

QUESTION 6 Assume you are studying a protein-coding gene, ACEX, which includes 4 exons as illustrated in the gene map below.Markere Pancreas Brain x EcoRIXECORI x BamHI X BamHI Pancreas Brain x EcoRIXECORI Markere Pancreas Pancreas Brain x EcoRI x EO BLOTI O BLOT II BLOT III O BLOT IV O BLOT V

QUESTION 7 Consider the hypothetical gene show here. The gene coding sequence consists of 4 exons (shown in solid colors). Th

QUESTION 8 Assume you are studying a protein-coding gene, SHCX, which includes 4 potential exons as illustrated in the gene m

QUESTION 11 Consider the hypothetical ACME gene shown here. This gene codes for a protein and consists of 3 exons. The sizes

For each of the statements below, indicate which of the fluorescent probes (A, B, and or C) would be able to hybridize to the

0 0
Add a comment Improve this question Transcribed image text
Answer #1

Q6)

Blot IV

The ACEX locus has two EcoRI sites, one at the beginning of Exon 2 and another at the end of 3' UTR. These two sites are 1325 bp apart on the DNA molecule, as Exon 2 is 200 bp, Intron 2 is 200 bp, Exon 3 is 300 bp, Intron 3 is 200 bp, Exon 4 is 400 bp and the 3' UTR is 25 bp long (200 + 200 + 300 + 200 + 400 + 25 = 1325).

The probe is complementary to Exon 4 and will bind any DNA molecule that includes that sequence.

Since we know that EcoRI treatment produces a 1325 bp fragment (in both Pancreatic and Brain DNA as the genome is the same in both these tissues.); Blot II and Blod IV are possibly those that are correct.

However, a DNA fragment that is bound by the probe against Exon 4 of ACEX cannot be longer than 1325 bp, as EcoRI will cleave all DNA molecules at those two sites. Therefore, the correct Blot cannot be Blot II as the EcoRI + BamHI digested bands are shown to be 1700 bp long.

Blot IV is the correct answer.

Q7)

  • Based on this information, the exons of the gene shown above include a total of 1050 nucleotides.

Since Exon 1 is 150 bp, Exon 2 is 200 bp, Exon 3 is 300 bp, Exon 4 is 400 bp, total number of nucleotides in the Exons is 150 + 200 + 300 + 400 = 1050

  • The mRNA will include 350 (= 1050/3) codons.
  • The number of amino acids in the protein translated from the mRNA is 349.

Since the last codon is the Stop Codon, it does not code for an Amino Acid. Therefore, 350 - 1 = 349 codons code for amino acids.

  • The approximate mass of the full-sized, non-processed protein will be 38.39 kDaltons

Since there are 349 amino acids, each with a mas of 110 Da, the total mass of the non-processed protein = 349 * 110 Da = 38390 Daton = 38.39 kDaltons

  • The first amino acid at the N terminus will be Methionine.

Methionine (Formyl-Methionine in Prokaryotes) is usually the N terminus Amino acid. In mature proteins, it is sometimes cleaved as part of the signal sequence/targeting sequence.

Q8)

Please include an image of the Northern Blot for an answer.

Q11)

Which probe or probes would be able to detect a 1000 bp fragment in a Southern Blot? (Eco RI digested DNA from Brain)

8. Probe A only

Since a DNA fragment 1000 bp is assayed, it can only be the fragment between the first and second EcoRI sites. Only Probe A is complementary to this region.

Which probe or probes would be able to detect a 1000 bp fragment in a Southern Blot? (EcoRI digested DNA from Liver)

8. Probe A only

Since DNA is the same in all cells, in this scenario as well, only Probe A will be able to detect the 1kb fragment.

Which probe or probes would be able to detect a 650 bp fragment in a Southern Blot? (Eco RI digested DNA from Brain)

1. Probe B and Probe C.

Both Probe B and Probe C are complementary to the 650 bp fragment produced by EcoRI digestion (the region between EcoRI site 2 and site 3)

Which single probe would be able to detect a 650 bp fragment and a 1000 bp fragment simultaneously in a Southern Blot

6. None; neither one of the probes (A, B, or C) would work.

This is because none of the probes is complementary to both the 1000 bp and the 650 bp fragments. Probe A is complementary only to the 1000 bp fragment while Probes B and C are complementary to the 650 bp fragment only.

Which probe or probes should be able to detect a fragment in a Northern Blot.
(RNA isolate from Brain tissue)

7. Probe B only

Since Northern Blots assay for RNA and only Probe B is complementary to an Exonic sequence, Probe B is the only Probe that will bind to the Nucleic acid in a Northern Blot.


Which probe or probes should be able to detect a band on a Western Blot

6. None; neither one of the probes (A, B, or C) would work.

Since these are DNA probes, they would not be able to bind the resultant Protein molecules that are assayed in a Western Blot.

Which probe or probes should be able to detect a fragment in a Northern Blot.
(RNA isolate from Liver tissue)

6. None; neither one of the probes (A, B, or C) would work.

Since this gene is not expressed in Liver cells, no RNA will be produced from the Liver corresponding to this gene. Therefore, none of the probes will be able to detect a fragment on a Northern blot of Liver tissue extract.


Which probe or probes would be useful in a Southern Blot analysis of the ACME locus but would NOT be useful in a Northern Blot Analysis.

3. Probe C only.


Since Probe C lies outside of the region of DNA that is transcribed, it ill be useful in Southern Blotting, where DNA is assayed, but not in Northern Blotting where RNA is used and therefore, Probe C has no complementary sequence.

Add a comment
Know the answer?
Add Answer to:
QUESTION 6 Assume you are studying a protein-coding gene, ACEX, which includes 4 exons as illustrated...
Your Answer:

Post as a guest

Your Name:

What's your source?

Earn Coins

Coins can be redeemed for fabulous gifts.

Not the answer you're looking for? Ask your own homework help question. Our experts will answer your question WITHIN MINUTES for Free.
Similar Homework Help Questions
  • Human protein X is encoded by human gene X. Gene X consists of 4 exons of...

    Human protein X is encoded by human gene X. Gene X consists of 4 exons of 200 bp each, interspersed with introns of 1,000 bp each. An mRNA cap will be found on ____________. (Pick all that apply.) the primary transcript the mRNA at least one of the lariats the poly(A) tail. exon 1 all exons some introns

  • A eukaryotic protein-encoding gene has three introns and 4 exons. A splicing repressor commonly binds to...

    A eukaryotic protein-encoding gene has three introns and 4 exons. A splicing repressor commonly binds to the 3' end of the second intron (introns 2/ exon three splice sites) draw the mRNA strand before and after splicing Diagram a final functional eukaryotic mRNA molecule from the 5' end to 3' end. There should be 7 items labeled in the diagram.

  • QUESTION 7 Consider the hypothetical gene show here. The gene coding sequence consists of 4 exons...

    QUESTION 7 Consider the hypothetical gene show here. The gene coding sequence consists of 4 exons (shown in solid colors). The 5' UTR and 3' UTR are shown as striped boxes. 25 150 200 300 400 25 Based on the lengths of the exons, you should be able to calculate a rough estimate of the protein encoded by this gene, assuming that all 4 exons are translated and the protein does not undergo any significant processing (cleavage or chemical modifications)....

  • 4. In future lectures we will describe a technique known as Northern blotting that can be...

    4. In future lectures we will describe a technique known as Northern blotting that can be used to detect RNA transcribed from a particular gene. Briefly, in this method a specific RNA is detected using a short segment of cloned DNA as a probe. The DNA probe, which is radioactive, is complementary to the RNA that the researcher wishes to detect. After the radioactive probe DNA basepairs to the RNA, the RNA is visualized as a dark (radioactive) band on...

  • Protein P is synthesized in relatively high amounts in the human pancreas. This protein has been...

    Protein P is synthesized in relatively high amounts in the human pancreas. This protein has been isolated and purified, but its amino acid sequence has not been determined. We wish to clone the gene for protein P. (a) How can a probe be prepared to identify the gene for protein P? (b) If we have prepared a radioactive messenger RNA as our probe in part (a), how could we verify that it is the mRNA for protein P? (c) If...

  • 2) A linear phage chromosome is labelled at both ends with 32P and digested with restriction...

    2) A linear phage chromosome is labelled at both ends with 32P and digested with restriction enzymes. EcoRI produces fragments of sizes 2.9, 4.5. 6.2.7.4, and 8.0 kb. An autoradiogram developed from a Southern blot of this digest shows radioactivity associated with the 6.2 and 8.0 fragments. BamHI cleaves the same molecule into fragments of sizes 6.0, 10.1 and 12.9; the label is found to be associated with the 6.0 and 10.1 fragments. When EcoRI and BamHI are used together,...

  • B. Based on lanes 4 and 3, which cell type has the more tubulin protein-NIH/3T3 cells?...

    B. Based on lanes 4 and 3, which cell type has the more tubulin protein-NIH/3T3 cells? Co cells? About the same? Can you tell? 14. As a way of contrasting the results of various molecular methods, answer each of the following questions. Note that each of these questions asks you to think about two methods that might seem superficially to yield similar information, but to focus how the results are different. A) What information would you get from a northern...

  • Questions 11-15: Gene structure/Splicing problem. "Protein X" consists of a total of 431 amino acids. Your...

    Questions 11-15: Gene structure/Splicing problem. "Protein X" consists of a total of 431 amino acids. Your colleague, techniques) the a biochemist, has purified the protein and determined (via complicated and messy chemical sequence of the first 37 amino acids in the protein, which she has reported to you as follows: HN- MSNITVDDELNLSREQQGFAEDDFIVIKEERETSLSP . nwhile, you have isolated a genomic clone of the gene that codes for protein X, and determined the DNA equence of the first 227 bases from the...

  • Question 2: a) You determine that xpd is expressed preferentially in muscle. Your colleague wants to...

    Question 2: a) You determine that xpd is expressed preferentially in muscle. Your colleague wants to know if any of the mutations affect the stability of the RNA transcript, thereby leading to higher turnover and lower overall mRNA levels. What techniques could you use to test her hypothesis? List the pros and cons of each method. (hint: try to think of at least three methods you could use) b) You find that your collegue is correct, and that the xpda...

ADVERTISEMENT
Free Homework Help App
Download From Google Play
Scan Your Homework
to Get Instant Free Answers
Need Online Homework Help?
Ask a Question
Get Answers For Free
Most questions answered within 3 hours.
ADVERTISEMENT
ADVERTISEMENT