If you have an enzyme that has a primary sequence that is 429 amino acids in length, is it possible that both an amino acid position 215, as well as amino acids located at 342, and 401, can all be part of an active site of a protein? Explain why or why not?
Answer: Yes
Explanation:
Proteins are heteropolymers of amino
acids linked together by peptide bonds. Proteins exhibit various
levels of structural organization.
Primary structure: The linear sequence of amino acids linked
together by peptide bonds
Secondary structure: Local conformation of the polypeptide backbone
Ex: Alpha helix and beta sheet
Tertiary structure: Overall #-dimensional conformation of the
protein
Quaternary structure: Interactions among individual subunits in a
multimeric protein
In the tertiary structure of a protein, the polypeptide chain is folded in a 3-dimensional manner so that amino acids that are far apart in the linear sequence can be brought adjacent to each other. Active site of many proteins contains amino acids that are far aprt in the linear sequence but are brought together by folding in 3D structure.
If you have an enzyme that has a primary sequence that is 429 amino acids in...
Which statement about enzyme catalysis is false? All of the active site amino acids are next to each other in the primary sequence. Enzymes speed up reactions by forming specific non-covalent bonds between the enzyme amino acids and the transition state molecule. Some enzymes require other molecules, called cofactors, to carry out chemical reactions. Generally, the most important amino acids for an enzyme's function are those in the active site. Question 6 1 pt When [S] is much more than...
Which sequence of amino acids, if any, would you predict to find in the interior of chymotrypsin (not the active site)? A. threonine, arginine, tyrosine B. glutamic acid, isoleucine, lysine C. valine, tryptophan, glycine D. None of the above. The answer is C, please explain why? Is it because those are hydrophobic amino acids?
You are studying an interesting protein in nematode worms that is 100 amino acids in length. Of particular interest is the fact that the last seven amino acids are all tryptophan (codons 94 through 100). Draw here the mRNA sequence for codons 94-100: Draw here the sequence of the DNA strand RNA polymerase used as its template (show 5' 3' polarity): You mutagenize the wild type worm. Assume for the next questions you are able to isolate both normal and...
QU. 5. You have identified the complete amino acid sequence on protein sequencing techniques. "Y" is composed of 44 amino acids with the po below. No information is available about its genetic sequence. Your task sequence for protein "Y". Assume that the gene sequence is unique in the human 5 BRIEFLY EXPLAIN methodically and accurately how you will decipher the gene seg "Y". (3 POINTS). no acid sequence of a human protein called "Y" using 1.44 amino acids with the...
Below, you can find a partial sequence of last 30 amino acids of a certain protein (amino acids, single-letter code). There are also mutated sequences of the same protein. Explain which mutations could have happened. (pay attention to the sequence length and the sequence itself) (25) Original GVLSEGEWQLVLHVWAKVEADVAGHGQDIL Mutant 1 GVLSEGEWQLVLHV Mutant 2 GVLSEGEWQLVHVWAKVEADVAGHGQDIL Mutant 3 GVLQHDAWQLVLHVWAKVEADVAGHGQDIL Mutant 4 GVLSEGEWQLVLHVWAKVEAWLWVMGHEVMLQ Mutant 5 GVLSEGEWQLVLHVWAKVEADVAGHGQDILWALWQAEVGQLIGH
THIS IS BIOCHEMISTRY A peptide has a low pI value. Which of the following amino acids are likely to be present? Glycine Serine Valine Aspartic aci Arginine The R-groups of which of the following pairs of amino acids could participate in the formation of salt bridge electrostatic interaction? Alanine and valine Valine and lysine Lysine and glutamate Serine and isoleucine Asparagine and glutamine Which of the following interactions does NOT contribute to stabilizing tertiary structure? Hydrophobic interactions Electrostatic interations...
Week 14- Chapter 21 Homework Problem 21.72 < 52 of 58 Review Constants| Periodic Table Part A How does a point mutation for an enzyme affect the order of amino acids in that protein? Drag the terms on the left to the appropriate blanks on the right to complete the sentences. Reset Help then the order of amino acids will change in the of the polypeptide chain If the resulting codon still codes for the same amino acid, If the...
Some amino acids are post-translationally removed from the C-terminal end of the beta-lactamase enzyme from B. imaginarium (i.e. - after it is translated and released from the ribosome, a protease chews off some amino acids). The wild-type enzyme, which has had the amino acids removed from the C’-terminus, is 246 amino acids in length and the C-terminal amino acids are shown below aligned with the C-terminal amino acids of a frameshift mutant, which – due to a frameshift mutation - is...
Some amino acids are post-translationally removed from the C-terminal end of the beta-lactamase enzyme from B. imaginarium (i.e. - after it is translated and released from the ribosome, a protease chews off some amino acids). The wild-type enzyme, which has had the amino acids removed from the C’-terminus, is 246 amino acids in length and the C-terminal amino acids are shown below aligned with the C-terminal amino acids of a frameshift mutant, which – due to a frameshift mutation - is...
19. The _structure of a protein refers to the linear sequence of amino acids in that protein. 20. Make up an example of the primary structure of a protein in the space below 21. The structure of a protein refers to a regular, recurring arrangement of the amino acid chain. One such arrangement, called the occurs when the amino acid chain forms a spiral or coil. Draw an example of this structure in the space below. 22. Another type of_...