Question

For the following list of peptides, predict which peptide would elute from the column first. Note that all conditions below a

   Are these answers correct?

Not changed since last attempt Marked out of 2.00 Question 5 Which peptide would elute last from a column that separates ONLY

Not changed since last attempt Marked out of 2.00 Question 6 Which peptide would be the last to elute from an anion exchange

Not changed since last attempt Marked out of 2.00 Question7 Predict which peptide would be the last to leave the column in a

0 0
Add a comment Improve this question Transcribed image text
Answer #1

5.) A

Sequence A has more hydrophobic amino acids as compared to other sequence, so on the basis of hydrophobicity , this sequence would be the last to elute out.

6.) B

Anion exchange chromatography , means matrix is anion exchanger ( has + charge) , and it binds to anion.

Sequence B would be the last to elute because it has more amino acids which has negatively charged side chains.

7.) E, this is correctly marked.

Add a comment
Know the answer?
Add Answer to:
   Are these answers correct? For the following list of peptides, predict which peptide would elute...
Your Answer:

Post as a guest

Your Name:

What's your source?

Earn Coins

Coins can be redeemed for fabulous gifts.

Not the answer you're looking for? Ask your own homework help question. Our experts will answer your question WITHIN MINUTES for Free.
Similar Homework Help Questions
  • Which of the following peptides will elute first in size-exclusion chromatography? Peptide 1: ASDCFRTYEWQCVNMKHFYLP Peptide 2:...

    Which of the following peptides will elute first in size-exclusion chromatography? Peptide 1: ASDCFRTYEWQCVNMKHFYLP Peptide 2: AWSDEGYIMN Peptide 3: MKLLVTYYICDEEPAQR Peptide 4: FVCCNTTRLEWWQNMSCKLAAPICNMRTTY O Peptide 1 Peptide 2 Peptide 3 Peptide 4

  • Use answers from answer bank and place in the correct bins. Peptides can be separated using...

    Use answers from answer bank and place in the correct bins. Peptides can be separated using an ion-exchange column based on their isoelectric (pl) values. At which pH values would two different peptides, one with a pl of 5.0 and the other with a pl of 9.2, bind to a cation- and anion-exchange column? Each peptide may be capable of binding to each column at more than one pH value. anion-exchange column at pH = 3.0 cation-exchange column at pH...

  • Pls help answer questions 1-5!! Which of these hormones could be taken orally? (multiple answers allowed)...

    Pls help answer questions 1-5!! Which of these hormones could be taken orally? (multiple answers allowed) Question 4 Not yet answered Marked out of 1.00 Select one or more: a. Estrogen b. Insulin Flag question c. T3/T4 O d. Biogenic amines Question 5 Which of the following would require a carrier protein to be soluble in the blood? Not yet answered Marked out of 1.00 Flag question Select one or more: O a. proteins/peptides O b. biogenic amines O c....

  • 16) At which pH values would two different peptides, one with a pl of 5.9 and...

    16) At which pH values would two different peptides, one with a pl of 5.9 and the other with a pl of 9.1, both bind to a cation exchange column? A) pH 3.9 B) pH 7.3 C) pH 10.9 D) None of the above 17) Which type of gel matrix (aka resin) would separate the following proteins using size exclusion chromatography: protein 1 (2,000 Da), protein 2 (7,000 Da), protein 3 (20,000 Da), and protein 4 (90,000 Da)? A) Gel...

  • Question 1 Not changed since last attempt Marked out of 2.00 P Flag question Following IFRS,...

    Question 1 Not changed since last attempt Marked out of 2.00 P Flag question Following IFRS, significant influence investments are usually called: Select one: O A. Investments in financial instruments O B. Long-term equity method investments O C. Noncurrent stock investments D. Investments in associates

  • Question 2 Not changed since last attempt Marked out of 2.00 P Flag question What is...

    Question 2 Not changed since last attempt Marked out of 2.00 P Flag question What is "value-in-use," as used in reporting intercorporate investments, per IFRS? Select one: O A. Market value of the investment in an active market O B. Present value of the investment's future expected cash flows 0 C. Market value of the investment when acquired o D. Present value of the investment's future dividend payments

  • DOBA101 Finish attempt ... Print Question 6 Not changed since last attempt Marked out of 2.00...

    DOBA101 Finish attempt ... Print Question 6 Not changed since last attempt Marked out of 2.00 P Hag question Rand Corporation acquires Southern Company's assets and liabilities for $20,000,000 in cash. At the date of acquisition, Southern's balance sheet reported assets of $75,000,000 and liabilities of $65,000,000. Investigation reveals that Southern's reported plant assets are overvalued by $1,400,000. Rand reports how much goodwill on this acquisition? Select one: A $8,600,000 O B. $11,400,000 O C. $7,000,000 O D, $10,000,000

  • Biochem help 2 14. What would be the net charge on the dipeptide Ser-His at pH-...

    Biochem help 2 14. What would be the net charge on the dipeptide Ser-His at pH- 6.04? (Choose the one best answer.) a) 1.5 b) +1; c) +0.5 d) 0 e) -0.5; 15. The pKa of a lysine side chain in a protein ending up on the outside of a globular protein has a different pKa than if the lysine is buried within the interior of a protein. What would be the expected pKa of a side chain of lysine...

  • Question 4 Not changed since last attempt Marked out of 2.00 P Flag question Grant Corporation...

    Question 4 Not changed since last attempt Marked out of 2.00 P Flag question Grant Corporation has owned 40% of the voting stock of Halliday Company for many years, originally purchased current year, the carrying value of the investment is $2,000,000. Halliday reports a loss of $6,000,000 for the yea What amount should Grant report as equity in the net loss of Halliday for the current year? Select one: o A. $2,000,000 O B. $2,400,000 O O C. none D....

  • Question 25 Which of the following is the correct formula for the profit margin ratio? Not...

    Question 25 Which of the following is the correct formula for the profit margin ratio? Not yet answered Marked out of 2.00 Select one: O A. Net profit * Capital invested O B. Net profit/ Sales P Flag question C. Net sales / Average total assets OD. Operating income / Net sales Question 26 Costs that do not differ between alternatives are Not yet answered Marked out of 2.00 P Flag question Select one: O A. important only if they...

ADVERTISEMENT
Free Homework Help App
Download From Google Play
Scan Your Homework
to Get Instant Free Answers
Need Online Homework Help?
Ask a Question
Get Answers For Free
Most questions answered within 3 hours.
ADVERTISEMENT
ADVERTISEMENT