Question

What is the major structural difference between glucagon and epinephrine? a. one is a peptide hormone...

What is the major structural difference between glucagon and epinephrine?

a. one is a peptide hormone & one is a small organic molecule

b. one is a charged organic molecule & one is neutral

c. one is negative and one is positive

d. one is amino acid based and one is RNA based

0 0
Add a comment Improve this question Transcribed image text
Know the answer?
Add Answer to:
What is the major structural difference between glucagon and epinephrine? a. one is a peptide hormone...
Your Answer:

Post as a guest

Your Name:

What's your source?

Earn Coins

Coins can be redeemed for fabulous gifts.

Not the answer you're looking for? Ask your own homework help question. Our experts will answer your question WITHIN MINUTES for Free.
Similar Homework Help Questions
  • What is the main difference between the activities of peptide hormones hormones? A. Peptide hormones do...

    What is the main difference between the activities of peptide hormones hormones? A. Peptide hormones do not bind to receptors B. Peptide hormones bind to cell surface receptors C. Peptide hormones bind to stretches of RNA D. Steroid hormones bind to intracellular receptors but peptide hormone surface receptors E. Steroid hormones stimulate the release of second messengers but act directly by DNA Hypoglycemia inhibits secretion of which of the following hormones? A. growth hormone B. insulin C. epinephrine D. thyroid...

  • Choose one of these hormones: Glucagon, Insulin, or Thyroid hormone. What factors will stimulate the release...

    Choose one of these hormones: Glucagon, Insulin, or Thyroid hormone. What factors will stimulate the release of this hormone? What are the metabolic effects of this hormone? (Be specific) Is this hormone regulated by a positive or negative feedback mechanism? Explain why.

  • 1. Given the following peptide, which of the following statements is true? Question options: a) The...

    1. Given the following peptide, which of the following statements is true? Question options: a) The N-terminal residue is leucine. b)This peptide contains 4 amino acid residues. c) The peptide contains a total of 6 ionizable groups. d) The net charge of this peptide at pH 7 is +1 Locate any peptide bond along the backbone of the given peptide. e) The bond between the C (of the C=O) and the N (of the N-H) of a peptide bond has...

  • short answer plase 3. What is the role of Conc. H2SO4 in Molisch's reagent test? bond...

    short answer plase 3. What is the role of Conc. H2SO4 in Molisch's reagent test? bond in proteins. 4. The positive Biuret test indicates the presence of "Speptible. 5. Why would amino acids give a negative result in the Biuret Test for Proteins? 6. Oxytocin is a hormone; it is a 9-amino acid peptide. Predict the results (+ or -) of the following tests on oxytocin: Biuret test: Ninhydrin test: 7. Describe the structural difference between saturated fatty acids and...

  • Imagine that you have just isolated a peptide hormone with the following primary sequence: MLSCRLQEALAALSKIVLADLGCVTGAPSDPR (Assume...

    Imagine that you have just isolated a peptide hormone with the following primary sequence: MLSCRLQEALAALSKIVLADLGCVTGAPSDPR (Assume the protein is in solution at physiological pH, and remember to include the amino acids at each end of the chain. A charge may come from the R-group, the N-terminus, and/or the C-terminus. If a residue occurs more than once, include each one in your answer.) List the residues (individual amino acids) that contribute a positive charge: ​ List the residues that contribute a...

  • what r the correct answers ? The major difference between a mutase and an isomerase enzyme...

    what r the correct answers ? The major difference between a mutase and an isomerase enzyme is Mutase transfers an entire group from one carbon to another, while an isomerase transfers a single atom Mutase causes mutations and isomerase causes isomerization Mutase transfers a single atom from one carbon to another while isomerase transfers entire group Mutase requires ATP while Isomerase does not require any ATP. According to the Chargaff's rule, number of purines = pyrimidines in a given strand...

  • What is the structural difference between the sugar found in RNA and the sugar found in...

    What is the structural difference between the sugar found in RNA and the sugar found in DNA? A. The presence of a 3’ hydroxyl B. The presence of a 2’ hydroxyl C. The presence of a 5’ hydroxyl D. The presence of a ring oxygen

  • 7. Hemoglobin, which carries oxygen to the cell, is an example b. storage of what type...

    7. Hemoglobin, which carries oxygen to the cell, is an example b. storage of what type of protein? d. transport c. hormone a. structural 8. An essential amino acid is an amino acid that a. must be provided in the diet. c. does not exist as a zwitterions. b. is missing from the diet d. is synthesized in the body. 9. This amino acid would be: a nonpolar and hydrophobic e. monpolar and hydrophilic b.polar and hydrophobie d. polar and...

  • Question • Peptide bonds form between ________. • A) amino acids • B) an mRNA codon...

    Question • Peptide bonds form between ________. • A) amino acids • B) an mRNA codon and a tRNA anticodon • C) a tRNA and the amino acid it is carrying • D) an mRNA transcript and the small ribosomal subunit

  • MATCHING Terec a adrenal giand E. glucagon g hormone h. insulin k thymus L thyroid gland mthyroxi...

    MATCHING Terec a adrenal giand E. glucagon g hormone h. insulin k thymus L thyroid gland mthyroxine n tropic hormone b. aldosterone beta cells d. calcitonin e endocrine gland osytocin For each of these definitions, select the correct matching term from the list above. 1. A hormone produced by the hypothalamus and released by the postesior lobe of che pituitary causes the uterus to contract and stimulates the release of milk from the mammary glands. 2 A hoemone secreted by...

ADVERTISEMENT
Free Homework Help App
Download From Google Play
Scan Your Homework
to Get Instant Free Answers
Need Online Homework Help?
Ask a Question
Get Answers For Free
Most questions answered within 3 hours.
ADVERTISEMENT
ADVERTISEMENT