Question

>AEH84521.1 protein of unknown function DUF150 [Mesorhizobium opportunistum WSM2075] MTAMTSEGDDRIIRESGIDARIALIIQPVLRGIGFRLVRVHLSGQNGLTLQIMAEREDGTMTVEDCEEVS RAVSPALDVDDPIEKAYHLEVSSPGIDRPLVRKSDFVTWTGHLVKMETSVVVADRKRFKGKIAEAGENDV LIERDKAAYGEEPTVRVPYDAI

>AEH84521.1 protein of unknown function DUF150 [Mesorhizobium opportunistum WSM2075]

MTAMTSEGDDRIIRESGIDARIALIIQPVLRGIGFRLVRVHLSGQNGLTLQIMAEREDGTMTVEDCEEVS

RAVSPALDVDDPIEKAYHLEVSSPGIDRPLVRKSDFVTWTGHLVKMETSVVVADRKRFKGKIAEAGENDV

LIERDKAAYGEEPTVRVPYDAISETRLILTDDLIRDALSKDNRARKEAKKRRGEPDDDVPEGTEADATEE

HEQES

What is the dominant biochemical activity

or

function

that your protein is predicted to

do

. Which sites on the protein contribute

to the process directly? Which sites contribute indirectly? How does the

predicted

function

relate to

the

biological function

of the cell

? What is expected to occur to

the organism if the gene that generates the

protein is inactivated?

Describe the

predicted structure of the protein.

Give a protein structure model of your protein.

If

applicable,

name the

operon

the gene of your protein belongs to

?

0 0
Add a comment Improve this question Transcribed image text
Answer #1

This protein based on the blast result is " ribosome maturation factor". This protein is required for the maturation of 30S subunit of ribosomes in prokaryotes. This maturation of ribosomes help in the ribosomes activation , so that protein translation could carry out. The sites present on the protein that help in processing their function is the amino acid between 103- 133 amino acid, that is required for the 30S subunit activation. The other sites is the amino acid between 3- 50 amino acid

Result of NCBI blast

If the gene required for the expression of this protein is inactivated , then the ribosome 30S subunit will not able to bind with mRNA and hence protein translation could not take place.

The 3D structure of the protein is

Add a comment
Know the answer?
Add Answer to:
>AEH84521.1 protein of unknown function DUF150 [Mesorhizobium opportunistum WSM2075] MTAMTSEGDDRIIRESGIDARIALIIQPVLRGIGFRLVRVHLSGQNGLTLQIMAEREDGTMTVEDCEEVS RAVSPALDVDDPIEKAYHLEVSSPGIDRPLVRKSDFVTWTGHLVKMETSVVVADRKRFKGKIAEAGENDV LIERDKAAYGEEPTVRVPYDAI
Your Answer:

Post as a guest

Your Name:

What's your source?

Earn Coins

Coins can be redeemed for fabulous gifts.

Not the answer you're looking for? Ask your own homework help question. Our experts will answer your question WITHIN MINUTES for Free.
Similar Homework Help Questions
  • Changes in protein expression can alter gene function since: High levels of protein mean that the...

    Changes in protein expression can alter gene function since: High levels of protein mean that the protein can sustain mutations more readily without any harm to the cell. The cell responds only to high levels of protein. Changes in expression can alter regulatory networks. Low levels of protein mean that the protein can sustain mutations more readily   without any harm to the cell. The mutations found in the CF gene that result in cystic fibrosis are recessive because: The CF...

  • A reporter gene--that is, a gene whose activity is relatively easy to detect--is commonly used to...

    A reporter gene--that is, a gene whose activity is relatively easy to detect--is commonly used to study promoter activity under a variety of investigative circumstances. Recombinant DNA technology is used to attach such a reporter gene to the promoter of interest, after which the recombinant molecule is inserted by transformation or transfection into the cell or host organism of choice. Green fluorescent protein (GFP) from the jellyfish Aequorea victoria fluoresces green when exposed to blue light. Assume that you wished...

  • Rewrite Information Below in vour Own Words This review provides an overview of the structure, function,...

    Rewrite Information Below in vour Own Words This review provides an overview of the structure, function, and catalytic mechanism of lacZ galactosidase. The protein played a central role in Jacob and Monod's development of the operon model for the regulation of gene expression. Determination of the crystal structure made it possible to understand why deletion of certain residues toward the amino-terminus not only caused the full enzyme tetramer to dissociate into dimers but also abolished activity. It was also possible...

  • Question 1 Question 2: Loss-of-function mutations in the CCR5 gene have been linked to resistance to...

    Question 1 Question 2: Loss-of-function mutations in the CCR5 gene have been linked to resistance to HIV infection. As a researcher you are interested in using CRISPR to provide protection against HIV. Provide a brief overview of the steps you would take to use CRISPR target the CCR5 gene in order to give someone resistance to HIV. Be sure to identify the main biochemical components, their function, and the cellular processes directly involved. A mutation in the RB gene prevents...

  • Yet, all the cells in your body contain the same genes (and same alleles). The difference...

    Yet, all the cells in your body contain the same genes (and same alleles). The difference across cell types is that genes get selectively expressed (turned on or off) based on the proteins needed for cellular function given their environment. Select which statement explains the reason why hair does not normally grow on your muscle cells. a. Muscle cells have the gene for keratin, but do not express it b. Muscle cells do not have the gene for keratin and...

  • 1) Which of the following conditions is most likely to cause the lactose operon to be...

    1) Which of the following conditions is most likely to cause the lactose operon to be transcribed? A) There is more glucose in the cell than lactose. B) There is glucose but no lactose in the cell. C) The cyclic AMP and lactose levels are both high within the cell. D) The CAMP level is high and the lactose level is low. 2) How does the transcription of structural genes in an inducible operon occur? A) It occurs continuously in...

  • Please answer 2-5 2. Consider a gene with a particular function. Mutation X and mutation Y...

    Please answer 2-5 2. Consider a gene with a particular function. Mutation X and mutation Y cach cause defects in the function of the encoded protein, yet a gene containing both mutations X and Y encodes a protein that works even better than the original protein. The odds are exceedingly small that a single mutational event will generate both mutations X and Y. Explain a simple way that an organism with a mutant gene containing both mutations X and Y...

  • 3. (2 points) In the nematode roundworm, Caenorhabditis elegans, the LIN-14 protein controls the timing of...

    3. (2 points) In the nematode roundworm, Caenorhabditis elegans, the LIN-14 protein controls the timing of certain cell divisions during development. LIN-14 protein levels are normally high in early development but decrease in the later stages. In a lin-4 mutant, the level of LIN-14 protein stays high throughout development, changing the pattern of cell divisions in the animal and producing defects in the shape of the animal. The lin-4 gene encodes a microRNA that binds to a sequence in the...

  • 19. Transfer RNA (TRNA) has two functional sites: 20. Three-base segments on mRNA that specify amino...

    19. Transfer RNA (TRNA) has two functional sites: 20. Three-base segments on mRNA that specify amino acids are called anticodons. True / False 21. Which of the following is not a product of transcription? a. A new strand of DNA b. rRNA c. tRNA 22. Structural genes encode for any protein or RNA molecules that are required for normal enzymatic or structural functions in the cell True False 23. Regulatory genes encode for protein and RNA molecules whose function is...

  • just 7, 8,9 7. The biochemical activity of a protein, such as its enzymatic activity, is...

    just 7, 8,9 7. The biochemical activity of a protein, such as its enzymatic activity, is called its function. a. phenotypic, b. genotypic, c. cellular, d. molecular, e. organismal 8. Which statement is NOT true of all naturally occurring DNA? a. Deoxyribose units are connected by 3'5'-phosphodiester bonds. b. The amount of A always equals the amount of T c. The ratio A+T/G+C is constant for all natural DNAS. d. The two complementary strands are antiparallel. e. Two hydrogen bonds...

ADVERTISEMENT
Free Homework Help App
Download From Google Play
Scan Your Homework
to Get Instant Free Answers
Need Online Homework Help?
Ask a Question
Get Answers For Free
Most questions answered within 3 hours.
ADVERTISEMENT
ADVERTISEMENT