4. Calculate the approximate number of amino acid residues contained within a single Protein X molecule.
4. Calculate the approximate number of amino acid residues contained within a single Protein X molecule.
Homework Answers
Add Answer to:
4. Calculate the approximate number of amino acid
residues contained within a single Protein X molecule.
Calculate the approximate number of amino acid residues contained within a single Protein X molecule. Questions...
Calculate the approximate number of amino acid residues
contained within a single Protein X molecule.
Questions #20-23 pertain to the SDS-PAGE images shown below. Gel A (left) is a non-reducing SDS-PAGE. Gel B (right) is a reducing SDS-PAGE. The M lanes contain molecular weight markers. Lanes 1, 2, &3 were loaded with equal volumes of a purified preparation of Protein X. Lane 4 was loaded with an equal volume of a crude preparation of Protein X (prior to purification). M...
Part B Assume a protein is composed of 115 amino acid residues and that each amino...
Part B Assume a protein is composed of 115 amino acid residues and that each amino acid can have three possible orlentations How many total possible orietations are thore do he rot Express the number of possible orientations to three significant figures. ΑΣφ 345 orientations Submit Incorrect; Try Again
Protein phosphorylation to amino acid residues is commonly involved with all of the following except A...
Protein phosphorylation to amino acid residues is commonly involved with all of the following except A regulation of transcription by extracellular signal molecules B. enzyme activation c activation of G-protein-linked receptors p. activation of protein kinase molecules
A protein biochemist attempted to determine the amino acid sequence of a decapeptide. Use the results...
A protein biochemist attempted to determine the amino acid sequence of a decapeptide. Use the results from the trypsin, chymotrypsin, and cyanogen bromide treatments to suggest the amino acid sequence of this decapeptide. Trypsin digestion gave two fragments with the following residues (not in order): T1: Ala, Arg, Phe, Pro, Thr, Trp, Tyr T2: Lys, Met, Val Chymotrypsin digestion gave three fragments with the following residues (not in order): CT1: Ala, Phe CT2: Pro, Arg CT3: Thr, Trp CT4: Lys,...
Calculate the approximate number of residues of Rubisco, which is involved in carbon fixation in plants,...
Calculate the approximate number of residues of Rubisco, which is involved in carbon fixation in plants, with a monomeric molecular weight of 55 kDa
anyone can help me with it? A protein biochemist attempted to determine the amino acid sequence...
anyone can help me with it?
A protein biochemist attempted to determine the amino acid sequence of a decapeptide. Use the results from the trypsin, chymotrypsin, and cyanogen bromide treatments to suggest the amino acid sequence of this decapeptide. Trypsin digestion gave two fragments with multiple residues (not in order): • T1: Ala, Arg, Phe, Gly, Thr, Trp, Tyr • T2: Lys, Met, Val Chymotrypsin digestion gave four fragments with multiple residues (not in order): • CT1: Ala, Phe •...
Indicate the amino acid sequence of the protein encoded by the following mRNA molecule. Use the...
Indicate the amino acid sequence of the protein encoded by the following mRNA molecule. Use the genetic code table and assume that the very first “AUG” the ribosome encounters will serve as the start codon. 5’-AAUUCAUGCCCAAAUUUGGGGCACGAAGCUUCUUAGGCUAGUCCUAAAAAA-3’
QUESTION 9 Sequence analysis of a membrane protein shows four 20 amino acid long stretches of...
QUESTION 9 Sequence analysis of a membrane protein shows four 20 amino acid long stretches of residues that are predominantly hydrophobic Between each of these stretches of hydrodophobic residues, a stretch of predominantly hydrophilic residues is found. From this observation one can reasonably postulate that: A this is a 4 stranded beta barrel which spans the membrane B.this is a glycoprotein o this protein has 4 alpha helical segments that span the membrane o this protein can be removed from...
A chain GIVEQCCASVCSLYQLENYCN B chain FVNQHLCGSHLVEALYLVCGERGFFYTPKA Shown above is the amino acid sequence of the hormone...
A chain GIVEQCCASVCSLYQLENYCN B chain FVNQHLCGSHLVEALYLVCGERGFFYTPKA Shown above is the amino acid sequence of the hormone insulin. This structure was determined by Frederick Sanger and his coworkers. Most of this work is described in a series of articles published in the Biochemical Journal from 1945 to 1955. When Sanger and colleagues began their work in 1945, it was known that insulin was a small protein consisting of two or four polypeptide chains linked by disulfide bonds. Sanger and his coworkers...
please help with these 5 questions Consider a polypeptide consisting of 19 amino acid residues. Its...
please help with these 5
questions
Consider a polypeptide consisting of 19 amino acid residues. Its structure is shown below. Lys-Tyr-Gly-Gly-Phe-Leu-Arg-Arg-Ile-Arg-Pro-Lys-Leu-Lys-Trp-Asp-Asn-Gln-Tyr . Draw the fragments that would result if the peptide was treated with trypsin. (No partial credit) . Draw the fragments that would result if the peptide was treated with chymotropsin. (No partial credit) MATCH a term from the list below to each definition. Place the letter of the term in the blank to the left of the definition...
Calculate the approximate number of amino acid residues
contained within a single Protein X molecule.
Questions #20-23 pertain to the SDS-PAGE images shown below. Gel A (left) is a non-reducing SDS-PAGE. Gel B (right) is a reducing SDS-PAGE. The M lanes contain molecular weight markers. Lanes 1, 2, &3 were loaded with equal volumes of a purified preparation of Protein X. Lane 4 was loaded with an equal volume of a crude preparation of Protein X (prior to purification). M...
Part B Assume a protein is composed of 115 amino acid residues and that each amino acid can have three possible orlentations How many total possible orietations are thore do he rot Express the number of possible orientations to three significant figures. ΑΣφ 345 orientations Submit Incorrect; Try Again
Protein phosphorylation to amino acid residues is commonly involved with all of the following except A regulation of transcription by extracellular signal molecules B. enzyme activation c activation of G-protein-linked receptors p. activation of protein kinase molecules
anyone can help me with it?
A protein biochemist attempted to determine the amino acid sequence of a decapeptide. Use the results from the trypsin, chymotrypsin, and cyanogen bromide treatments to suggest the amino acid sequence of this decapeptide. Trypsin digestion gave two fragments with multiple residues (not in order): • T1: Ala, Arg, Phe, Gly, Thr, Trp, Tyr • T2: Lys, Met, Val Chymotrypsin digestion gave four fragments with multiple residues (not in order): • CT1: Ala, Phe •...
QUESTION 9 Sequence analysis of a membrane protein shows four 20 amino acid long stretches of residues that are predominantly hydrophobic Between each of these stretches of hydrodophobic residues, a stretch of predominantly hydrophilic residues is found. From this observation one can reasonably postulate that: A this is a 4 stranded beta barrel which spans the membrane B.this is a glycoprotein o this protein has 4 alpha helical segments that span the membrane o this protein can be removed from...
A chain GIVEQCCASVCSLYQLENYCN B chain FVNQHLCGSHLVEALYLVCGERGFFYTPKA Shown above is the amino acid sequence of the hormone insulin. This structure was determined by Frederick Sanger and his coworkers. Most of this work is described in a series of articles published in the Biochemical Journal from 1945 to 1955. When Sanger and colleagues began their work in 1945, it was known that insulin was a small protein consisting of two or four polypeptide chains linked by disulfide bonds. Sanger and his coworkers...
please help with these 5
questions
Consider a polypeptide consisting of 19 amino acid residues. Its structure is shown below. Lys-Tyr-Gly-Gly-Phe-Leu-Arg-Arg-Ile-Arg-Pro-Lys-Leu-Lys-Trp-Asp-Asn-Gln-Tyr . Draw the fragments that would result if the peptide was treated with trypsin. (No partial credit) . Draw the fragments that would result if the peptide was treated with chymotropsin. (No partial credit) MATCH a term from the list below to each definition. Place the letter of the term in the blank to the left of the definition...
Most questions answered within 3 hours.
-
Where is the error in this code sequence?
String s1 = "Hello";
String s2 = "ello";...
asked 11 months ago -
Financial data for Joel de Paris, Inc., for last year
follow:
Joel de Paris, Inc.
Balance...
asked 11 months ago -
Consider this reaction:
Al2(SO4)3 (aq)+ BaCl3
(aq) Al2Cl6 (aq)- +
3BaSO4(s) . What is the...
asked 11 months ago -
Suppose that Savneet is considering increasing her
recent random sample from 20 car rentals to 40...
asked 11 months ago -
Trucks arrive at an unloading terminal at an average rate of 120
per hour.
Trucks arrive...
asked 11 months ago -
Why are methanol and ethanol completely soluble in water while
octanol is not very little soluble....
asked 11 months ago -
A facilities manager at a university reads in a research report
that the mean amount of...
asked 11 months ago -
When the CuSO4 is rehydrated by adding water to the anhydrous
compound, is this an endothermic...
asked 11 months ago -
A ray of sunlight is passing from diamond into crown glass; the
angle of incidence is...
asked 11 months ago -
A block of mass 0.249 kg is placed on top of a light, vertical
spring of...
asked 11 months ago -
how do the kidneys compensate in the presences of acidosis
a) trigger hyperventilate
b) reserve acid...
asked 11 months ago -
Question 501 pts
The rental rate of capital to the firm increases. Which of the
following...
asked 11 months ago