Question

In your membrane fraction that you gently isolated from the cell you have an enzyme activity that you are interested in study
0 0
Add a comment Improve this question Transcribed image text
Answer #1

1. If the protein is having an enzymatic activity that is present either on the peripheral or the integral part of the cell membrane then it is important to validate the location of the active protein present in the cell membrane. The NaCl which is the salt can be used for the separation of the cell membrane from the peripheral protein. Further, the centrifugation can be carried out and if the protein presence has been seen in the pellet then the protein can be said to be the integral protein in the cell membrane while if the protein is present in the supernatant then it can be seen to be the peripheral protein.

Ahead of this isolation, the protein can be checked for the enzymatic action by treating it with the substrate which binds to the protein and thus through the enzyme kinetics it can be found that which protein is shwoing the enzymatic activity and working as an enzyme.   

2. If it is the integral membrane protein then the negatively charged amino acid which can bind to the hydrophobic part of the lipid membrane can be seen in the protein which are either aspartic acid or the glutamic acid. While if the protein is present on the peripheral region then the binding of the protein has to take place on the hydrophilic head of the phospholipids and thus the positively charged amino acids such as the lysine and arginine or histidine can be seen to be present in the peripheral proteins.

Add a comment
Know the answer?
Add Answer to:
In your membrane fraction that you gently isolated from the cell you have an enzyme activity...
Your Answer:

Post as a guest

Your Name:

What's your source?

Earn Coins

Coins can be redeemed for fabulous gifts.

Not the answer you're looking for? Ask your own homework help question. Our experts will answer your question WITHIN MINUTES for Free.
Similar Homework Help Questions
  • Question 4 Multi-Part Questions. Make sure to answer ALL parts (a-c)! You have isolated two versions...

    Question 4 Multi-Part Questions. Make sure to answer ALL parts (a-c)! You have isolated two versions of the same enzyme, a wild type and mutant. The marteses You have determined the following kinetic characteristics for each of the enzymes. Vmax Wild Type Km 200 umol / min 0.2mm Mutant 2 umol / min 20mm and the reaction is a two-step reaction where k.1 is much larger than k3, which enzyme has the higher affinity for substrate to you You determine...

  • 1) In order to do an enzyme activity assay you must isolate your favorite enzyme from...

    1) In order to do an enzyme activity assay you must isolate your favorite enzyme from the cell. After isolating your enzyme you find that the active form of the enzyme is 6x the size that the primary structure would suggest. What is likely true about your enzyme? a)It has denatured, but NOT aggregated b) It has lost its original primary structure c) It has quaternary structure d) It has mostly beta-strand secondary structure e) It has denatured and aggregated...

  • You have an enzyme solution at a concentration of 5mg/ml. The enzyme activity you determine is...

    You have an enzyme solution at a concentration of 5mg/ml. The enzyme activity you determine is 0.1 Units per microliters of undiluted protein. What is the specific activity of the enzyme (U/mg)?

  • 4. A certain protein is known to be embedded within a cell membrane. What type of...

    4. A certain protein is known to be embedded within a cell membrane. What type of amino acids would you expect this protein to contain on its surface and why? 5. Structural proteins form the basis for hair and nails and have a high cysteine content. Cysteine side groups (-CH2SH) can react with each other to form disulfide bridge. What type of bonding holds the bridge together? Why is this interaction important for the function of structural proteins? Hemoglobin is...

  • 3 nate 0 Some proteins are embedded in the nonpolar phospholipid bilayer of a cell membrane....

    3 nate 0 Some proteins are embedded in the nonpolar phospholipid bilayer of a cell membrane. How would you expect the three-dimensional structures of these proteins to differ from phycocyanin and other water-soluble proteinse 7 Determine whether each statement below is true or false. Explain your reasoning. a. Two different proteins may be generated from the same number and type of amino acids. True False b. Enzymes that break down proteins into their constituent amino acids catalyze the process of...

  • 1) What types of amino acids would you expect to find in the membrane-spanning region(s) of...

    1) What types of amino acids would you expect to find in the membrane-spanning region(s) of a membrane protein? Why? 2) What is the connection between “surface area-to-volume ratio” and cell size? Why are unicellular organisms much more limited by this (in general terms, why do they have to be small?)?     3) What is the difference between general transcription factors and transcriptional regulators? If you compared one of each type, which would you expect to be more abundant in...

  • You have isolated a lyophilized (in powder form) protein from a particular cell line. You have...

    You have isolated a lyophilized (in powder form) protein from a particular cell line. You have at least a gram of the material and a completely equipped laboratory including instruments, supplies, and reagents. List the steps you would take to determine the absorptivity of your protein in units of mL/mg·cm.

  • Imagine that you have just isolated a peptide hormone with the following primary sequence: MLSCRLQEALAALSKIVLADLGCVTGAPSDPR (Assume...

    Imagine that you have just isolated a peptide hormone with the following primary sequence: MLSCRLQEALAALSKIVLADLGCVTGAPSDPR (Assume the protein is in solution at physiological pH, and remember to include the amino acids at each end of the chain. A charge may come from the R-group, the N-terminus, and/or the C-terminus. If a residue occurs more than once, include each one in your answer.) List the residues (individual amino acids) that contribute a positive charge: ​ List the residues that contribute a...

  • A crude cell extract containing 2 g.L -1 of protein was assayed for enzyme activity using...

    A crude cell extract containing 2 g.L -1 of protein was assayed for enzyme activity using an excess of substrate. It was found that 5 ml of the solution converted 25 µmoles of substrate to product over a period of 2 minutes. (i) Calculate the specific activity of the enzyme. The crude extract was subjected to anion exchange chromatography followed by gel filtration. After anion exchange the specific activity had risen to 226 µmoles.min-1 .mg-1 , and after gel filtration...

  • Are you graduating in December 201 YES/NO 1) Which enzyme is needed for the oxidation of...

    Are you graduating in December 201 YES/NO 1) Which enzyme is needed for the oxidation of odd-chain saturated fatty acids that is not needed 1) for even-chain fatty acids? A) methylmalonyl-CoA mutase C) methylmalonyl-CoA racemase B) D) All of the above 2) When red-blood cells are treated extensively with protease most down into small peptides. However, some proteins are very resistant to this treatment. 1f cleavage by protease is the only type of reaction that occurs in this treatment, how...

ADVERTISEMENT
Free Homework Help App
Download From Google Play
Scan Your Homework
to Get Instant Free Answers
Need Online Homework Help?
Ask a Question
Get Answers For Free
Most questions answered within 3 hours.
ADVERTISEMENT
ADVERTISEMENT