Homework Answers
The modified picture with N
terminus and C-terminus is given along with the order of amino
acids in a tripeptide and in a tetrapeptide.
Add Answer to:
Proteins are directional, meaning that they have a definite beginning and end The beginning of a...
QUESTION 13 What chemical group is at the end of an amino acid chain corresponding to...
QUESTION 13 What chemical group is at the end of an amino acid chain corresponding to the 3' end of the mRNA molecule? A. Peptide bond B.5 phosphate group C.3" hydroxyl group D. Amino (N-terminus) E. Carboxyl (C-terminus) QUESTION 14 Which of the following is true regarding pre-mRNA modifications/processing? O A. Alternative splicing allows for increased complexity and synthesis of protein isomers OB. The 5' cap is added after RNA polymerase dissociates from the gene OC. The poly A tail...
A chain GIVEQCCASVCSLYQLENYCN B chain FVNQHLCGSHLVEALYLVCGERGFFYTPKA Shown above is the amino acid sequence of the hormone...
A chain GIVEQCCASVCSLYQLENYCN B chain FVNQHLCGSHLVEALYLVCGERGFFYTPKA Shown above is the amino acid sequence of the hormone insulin. This structure was determined by Frederick Sanger and his coworkers. Most of this work is described in a series of articles published in the Biochemical Journal from 1945 to 1955. When Sanger and colleagues began their work in 1945, it was known that insulin was a small protein consisting of two or four polypeptide chains linked by disulfide bonds. Sanger and his coworkers...
1. Please provide correct solution. Thank you. Acid rain is a serious environmental problem. A sample...
1. Please provide correct solution. Thank you.
Acid rain is a serious environmental problem. A sample of rainwater collected in the Sierra Mountains had an H+ concentration of 0.1 mmol/L. The pH of this sample was 0 1 3 4 100 Rank the elements carbon (C), hydrogen (H), oxygen (O), and phosphorus (P) in decreasing order number of covalent bonds they usually form. C > P > N > O >H P > O > C > N > H...
When you drink a cup of milk, what happens to the protein in the milk after...
When you drink a cup of milk, what happens to the
protein in the milk after it has been swallowed? To describe these
processes, you must be able to use the vocabulary
effectively.
FILL IN THE BLANKS
tripeptide is the active form of a digestive enzyme in the stomach that breaks polypeptide chains into smaller acid group polypeptides. dipeptide 2. Cleavage of proteins by pepsin in the stomach results in formation of which get broken down amino acids further in...
Explain this question please! Name (4 ofer to the Table of Amino Acids at the beginning of the exam to help solve this problem. Polypeptide I is a 12-mer and has the following amino acid compositi...
Explain this question please!
Name (4 ofer to the Table of Amino Acids at the beginning of the exam to help solve this problem. Polypeptide I is a 12-mer and has the following amino acid composition: Ala, Arg, 2 His, Leu, 2 Lys, 2 Phe, Ser, Thr, Trp Edman degradation of I shows that its N-terminal amino acid is His. Chymotrypsin cleavage of I yields peptide fragments A-D.Trypsin cleavage of I gives peptide fragments E-G. Shown below is the amino...
Which of the following is NOT a dehydration synthesis reaction? a. amino acids forming proteins b....
Which of the following is NOT a dehydration synthesis reaction? a. amino acids forming proteins b. glycogen forming glucose molecules c. nucleotides forming DNA d. glucose units forming starch e .fatty acids and glycerol forming a fat 2) The monomer of a protein is a(n) monosaccharide. nucleotide. peptide. glycerol and three fatty acids. amino acid. 3) A starch molecule is to glucose as a protein is to a polypeptide. DNA is to an amino acid. a lipid is to nucleic...
4. A polypeptide is shown below: HAN-C-C-N-C-C-N-C-C-N-C-C-N-C-c-N-C-C-N-C- CH3 CH2 CH2 CH CH2 SH CH2 CH SH...
4. A polypeptide is shown below: HAN-C-C-N-C-C-N-C-C-N-C-C-N-C-c-N-C-C-N-C- CH3 CH2 CH2 CH CH2 SH CH2 CH SH OH CH2 CH2 CH2 NH3 a. b. C- d. Circle all the peptide bonds in the polypeptide above. Under each amino acid indicate if it is polar, non-polar or electrically charged Label the N-terminus and the C-terminus Label the amino acids that are hydrophobic. the lab, biologists can create a cell surrounded by a phospholipid bilayer membrane that contains no transmembrane proteins. These structures...
Protein Structure A protein contains a string of amino acids (usually more than 50) that has...
Protein Structure A protein contains a string of amino acids (usually more than 50) that has a biological function. 15ecause proteins are so large, their structure has several levels, all of which are important for the proper functioning of the protein. Ultimately, the sequence of amino acids (ordering of polar and nonpolar amino acids) dictates the 3-dimensional shape of a protein and this dictates its primary function. Level 1: Primary (1") The amino acid sequence of a polypeptide Protein Backbone...
COLOR 2 mlogg albumen 2 mL. honey 2 ml. amino acid solution 2 mL. distilled water...
COLOR 2 mlogg albumen 2 mL. honey 2 ml. amino acid solution 2 mL. distilled water 2 mL. peosein solution bWhich contains more protein (C-N bonds), egg albu- men or honey? How can you tell? Amino acid Amino ackd e. Do free amino acids have peptide bonds? d. What are the functions of proteins in living organisms? но HOH O Polypeptide chain Figure 6.7 A peptide bond joins two amino acids, and pepside bonds link mmany amino acids to form...
a. Circle a Monomer of this polymer
.1. a. Circle a Monomer of this polymer b. Name and label the type of bond formed between any two glucose molecules c. What type of Polymer does the above image represent?2.a. Circle the molecules involved in the Dehydration reaction between two amino acids b. What type of bond is formed between any two amino acids c. Label the peptide bond d. Label the amino end and carboxyl end of the dipeptide 3.a. Identify the Glycerol Backbone and Fatty acid chain b. Circle the molecules involved in the...
QUESTION 13 What chemical group is at the end of an amino acid chain corresponding to the 3' end of the mRNA molecule? A. Peptide bond B.5 phosphate group C.3" hydroxyl group D. Amino (N-terminus) E. Carboxyl (C-terminus) QUESTION 14 Which of the following is true regarding pre-mRNA modifications/processing? O A. Alternative splicing allows for increased complexity and synthesis of protein isomers OB. The 5' cap is added after RNA polymerase dissociates from the gene OC. The poly A tail...
A chain GIVEQCCASVCSLYQLENYCN B chain FVNQHLCGSHLVEALYLVCGERGFFYTPKA Shown above is the amino acid sequence of the hormone insulin. This structure was determined by Frederick Sanger and his coworkers. Most of this work is described in a series of articles published in the Biochemical Journal from 1945 to 1955. When Sanger and colleagues began their work in 1945, it was known that insulin was a small protein consisting of two or four polypeptide chains linked by disulfide bonds. Sanger and his coworkers...
1. Please provide correct solution. Thank you.
Acid rain is a serious environmental problem. A sample of rainwater collected in the Sierra Mountains had an H+ concentration of 0.1 mmol/L. The pH of this sample was 0 1 3 4 100 Rank the elements carbon (C), hydrogen (H), oxygen (O), and phosphorus (P) in decreasing order number of covalent bonds they usually form. C > P > N > O >H P > O > C > N > H...
When you drink a cup of milk, what happens to the
protein in the milk after it has been swallowed? To describe these
processes, you must be able to use the vocabulary
effectively.
FILL IN THE BLANKS
tripeptide is the active form of a digestive enzyme in the stomach that breaks polypeptide chains into smaller acid group polypeptides. dipeptide 2. Cleavage of proteins by pepsin in the stomach results in formation of which get broken down amino acids further in...
Explain this question please!
Name (4 ofer to the Table of Amino Acids at the beginning of the exam to help solve this problem. Polypeptide I is a 12-mer and has the following amino acid composition: Ala, Arg, 2 His, Leu, 2 Lys, 2 Phe, Ser, Thr, Trp Edman degradation of I shows that its N-terminal amino acid is His. Chymotrypsin cleavage of I yields peptide fragments A-D.Trypsin cleavage of I gives peptide fragments E-G. Shown below is the amino...
4. A polypeptide is shown below: HAN-C-C-N-C-C-N-C-C-N-C-C-N-C-c-N-C-C-N-C- CH3 CH2 CH2 CH CH2 SH CH2 CH SH OH CH2 CH2 CH2 NH3 a. b. C- d. Circle all the peptide bonds in the polypeptide above. Under each amino acid indicate if it is polar, non-polar or electrically charged Label the N-terminus and the C-terminus Label the amino acids that are hydrophobic. the lab, biologists can create a cell surrounded by a phospholipid bilayer membrane that contains no transmembrane proteins. These structures...
Protein Structure A protein contains a string of amino acids (usually more than 50) that has a biological function. 15ecause proteins are so large, their structure has several levels, all of which are important for the proper functioning of the protein. Ultimately, the sequence of amino acids (ordering of polar and nonpolar amino acids) dictates the 3-dimensional shape of a protein and this dictates its primary function. Level 1: Primary (1") The amino acid sequence of a polypeptide Protein Backbone...
COLOR 2 mlogg albumen 2 mL. honey 2 ml. amino acid solution 2 mL. distilled water 2 mL. peosein solution bWhich contains more protein (C-N bonds), egg albu- men or honey? How can you tell? Amino acid Amino ackd e. Do free amino acids have peptide bonds? d. What are the functions of proteins in living organisms? но HOH O Polypeptide chain Figure 6.7 A peptide bond joins two amino acids, and pepside bonds link mmany amino acids to form...
Most questions answered within 3 hours.
-
Where is the error in this code sequence?
String s1 = "Hello";
String s2 = "ello";...
asked 10 months ago -
Financial data for Joel de Paris, Inc., for last year
follow:
Joel de Paris, Inc.
Balance...
asked 10 months ago -
Consider this reaction:
Al2(SO4)3 (aq)+ BaCl3
(aq) Al2Cl6 (aq)- +
3BaSO4(s) . What is the...
asked 10 months ago -
Suppose that Savneet is considering increasing her
recent random sample from 20 car rentals to 40...
asked 10 months ago -
Trucks arrive at an unloading terminal at an average rate of 120
per hour.
Trucks arrive...
asked 10 months ago -
Why are methanol and ethanol completely soluble in water while
octanol is not very little soluble....
asked 10 months ago -
A facilities manager at a university reads in a research report
that the mean amount of...
asked 10 months ago -
When the CuSO4 is rehydrated by adding water to the anhydrous
compound, is this an endothermic...
asked 10 months ago -
A ray of sunlight is passing from diamond into crown glass; the
angle of incidence is...
asked 10 months ago -
A block of mass 0.249 kg is placed on top of a light, vertical
spring of...
asked 10 months ago -
how do the kidneys compensate in the presences of acidosis
a) trigger hyperventilate
b) reserve acid...
asked 10 months ago -
Question 501 pts
The rental rate of capital to the firm increases. Which of the
following...
asked 10 months ago