Question

QUESTION 13 What chemical group is at the end of an amino acid chain corresponding to the 3 end of the mRNA molecule? A. Pep
Which of the following is true regarding the mRNA strand indicated below where upper case letters represent exons and lower c
The covalent bond between nucleotides of a single nucleotide chain is a bond between amino acids of a polypeptide chain is a
0 0
Add a comment Improve this question Transcribed image text
Answer #1

QUESTION 13-

E. Carboxyl (C-terminus) - The C-terminus is the end of an amino acid chain (protein or polypeptide), terminated by a free carboxyl group (-COOH). and mRNA codons are read from 5' to 3' , and they specify the order of amino acids in a protein from N-terminus (methionine) to C-terminus.

QUESTION 14-

D. 5' cap is necessary for recognition by the small ribosomal subunit- the cap plays a role in the ribosomal recognition of messenger RNA during translation into a protein which attributed to protein factors that bind specifically to the cap structure: the cap-binding complex (CBC) in the nucleus and eIF4E in the cytoplasm.

A. The open reading frame (ORF) encodes the polypeptides: N-met-asp-phe-C: since start codon AUG codes for met , GAC codes for asp and UUC codes for phe then stop codon UGA comes and chain terminates.

QUESTION 15-

B. AUG/release factor- translation initiates when ribosomes recognises the 1st AUG start codon codes for metheonine.Termination happens when a stop codon in the mRNA (UAA, UAG, or UGA) enters the A site. Stop codons are recognized by proteins called release factors.

A. Phasphodiester/peptide-

Nucleotides are linked together by the formation of a phosphodiester bond which is formed between the 3' -OH group of one sugar molecule, and the 5' phosphate group on the adjacent sugar molecule. This results in a loss of a molecule of water, making this a condensation reaction, also called a dehydration synthesis.

The bond that holds together the two amino acids is a peptide bond, It occurs when the carboxylic group of one molecule reacts with the amino group of the other molecule, linking the two molecules and releasing a water molecule.

QUESTION 27-

D. Quartenary- The quaternary structure of a hemoglobin molecule includes four tertiary structure protein chains, Most of the amino acids in hemoglobin form alpha helices, and these helices are connected by short non-helical segments.. Individually, each alpha helix is a secondary polypeptide structure made of amino acid chains. The amino acids are in turn the primary structure of hemoglobin.

Add a comment
Know the answer?
Add Answer to:
QUESTION 13 What chemical group is at the end of an amino acid chain corresponding to...
Your Answer:

Post as a guest

Your Name:

What's your source?

Earn Coins

Coins can be redeemed for fabulous gifts.

Not the answer you're looking for? Ask your own homework help question. Our experts will answer your question WITHIN MINUTES for Free.
Similar Homework Help Questions
  • Place the following steps of TRANSLATION in the correct order for EUKARYOTES. The ribosome reaches a...

    Place the following steps of TRANSLATION in the correct order for EUKARYOTES. The ribosome reaches a stop codon. A release factor binds and causes the release of the new polypeptide, along with the mRNA. The ribosome dissociates. v Acharged tRNA with a matching anticodon binds the mRNA codon in the A site. ✓ The ribosome moves exactly 3 nucleotides toward the 3* end of the mRNA. The small ribosomal subunit uses rRNA to bind to the Kozak sequence, which places...

  • QUESTION 1 RNA poll initiates synthesis of the mRNA transcript without a primer True O False...

    QUESTION 1 RNA poll initiates synthesis of the mRNA transcript without a primer True O False QUESTION 2 En The +1 position identifies the location for translation to begin when bound the mRNA is bound by the ribosomal subunit. True False QUESTION 3 The small ribosomal subunit binds the mRNA transcript at a sequence that is complementary to the gene promoter in order to initiate translation. O True False QUESTION 4 The 5' cap is necessary for protection from exonuclease...

  • A chain GIVEQCCASVCSLYQLENYCN B chain FVNQHLCGSHLVEALYLVCGERGFFYTPKA Shown above is the amino acid sequence of the hormone...

    A chain GIVEQCCASVCSLYQLENYCN B chain FVNQHLCGSHLVEALYLVCGERGFFYTPKA Shown above is the amino acid sequence of the hormone insulin. This structure was determined by Frederick Sanger and his coworkers. Most of this work is described in a series of articles published in the Biochemical Journal from 1945 to 1955. When Sanger and colleagues began their work in 1945, it was known that insulin was a small protein consisting of two or four polypeptide chains linked by disulfide bonds. Sanger and his coworkers...

  • 22. What are the roles of Dicer and RISC in the function of miRNAs? Dicer RISC...

    22. What are the roles of Dicer and RISC in the function of miRNAs? Dicer RISC 23. Describe the concepts of primary, secondary, tertiary and quaternary protein structure 24. Here is a short sequence of codons. AUG CAU UGU UUU Write out the amino acids this sequence of codons encodes. Now add an insertion mutation of your choosing in the first codon and write out the new mutant sequence. What are the first four amino acids encoded by this mutant...

  • Polymerization of amino acids into a polypeptide requires energy. In terms of chemical thermodynamics, the chemical...

    Polymerization of amino acids into a polypeptide requires energy. In terms of chemical thermodynamics, the chemical energy for peptide bond formation in translation technically comes from: hydrolysis of GTP hydrolysis of ATP translocation of the ribosome as it moves along the mRNA ribosomal RNA (rRNA) secondary structure transcription of the mRNA that is being translated Transfer RNA (tRNA) is a ribonucleic acid about 50-60 nucleotides long. When a tRNA gets "charged" by covalent addition of its cognate amino acid, to...

  • Repo Fill in the needed bases, codon, anticodon, or amino acid needed to complete the following...

    Repo Fill in the needed bases, codon, anticodon, or amino acid needed to complete the following table that relates the sequences of DNA, mRNA, RNA, and the resulting polypeptide. DNA informational strand: 5' end 3' end Guide DNA template strand: 3' end GTC CCC GCG GGG ACG TTG 5' end mRNA codons: 5' end 5' end 0 0 3'end 3' end tRNA anticodons: Polypeptide: TABLE 22.3 The Genetic Code - Triplets in Messenger RNA First Base (5 end) Second Base...

  • c) The steps or rungs of the DNA ladder are composed of phosphate group 4 Deoxyribose...

    c) The steps or rungs of the DNA ladder are composed of phosphate group 4 Deoxyribose 15. Use Figure 2 and 3 of the lab to compare the genome of a human with a mouse, fruit fly and yeast. paired in a specific way. d) Adenine in one DNA strand always pain with thymine ) Bases in opposite strands of a DNA molecule are linked together by hydrogen in the other strand and bonds. Yeast Human Mouse Fruit Fly Number...

  • Namer A) alternating sugar and nitrogen bases liked by peptide bonds B) complimentary bases held ...

    Namer A) alternating sugar and nitrogen bases liked by peptide bonds B) complimentary bases held together by hydrogen bonds 6) The backbone of a niacleic acid strand consists of: alternating sugar and phosphate groups linked by phosphate ester bonds D) alternating nitrogen bases and phosphate groups linked by amide bonds Q 7) 刁what amino acids are involved in the following tripeptide? NH-CH-C-NH-CH-- CH NH OH D) His-Lys-Phe A) Tyr-His-Lys C) Lys-His-Tyr B) Lys-His-Phe 8) Which list contains only neutral polar...

  • 13. A researcher studying hemoglobin predicts tha aying hemoglobin predicts that a histidine within the protein...

    13. A researcher studying hemoglobin predicts tha aying hemoglobin predicts that a histidine within the protein is Portant for binding oxygen. She used site-directed mutagenesis to change histidine (CAU) to one for lysine (AAA). However, the mutant hemos as well as the wild-type and has no other apparent changes. This type utagenesis to change a codon for the mutant hemoglobin still binds oxygen anges. This type of mutation is called A. suppression B. synonymous C. nonsense D. silent E. frameshift...

  • 26. Which of the following classification does not match the amino acid side chain A) Contains an basic group/ lysi...

    26. Which of the following classification does not match the amino acid side chain A) Contains an basic group/ lysine B) It is polar C) Forms disulfide bond/ cysteine D) Forms hydrogen bonds with neighbors/ alanine serine 27. All amino acids found in proteins are L-amino acids EXCEPT the achiral. A) glutamate B) Lysine C) glyeine D) Alamine 28. The plH at which the positive and negative charges of an amino acid balance each ofher is called the A) isotonic...

ADVERTISEMENT
Free Homework Help App
Download From Google Play
Scan Your Homework
to Get Instant Free Answers
Need Online Homework Help?
Ask a Question
Get Answers For Free
Most questions answered within 3 hours.
ADVERTISEMENT
ADVERTISEMENT