When an amino acid chain folds into a protein, the entropy of the system decreases. Explain...
When an amino acid chain folds into a protein, the entropy of the system decreases. Explain what factor(s) allow for the folding of a protein to be spontaneous despite the entropy decrease of the system.
Homework Answers
Add Answer to:
When an amino acid chain folds into a protein, the entropy of
the system decreases. Explain...
Pls answer fast Discuss how the properties of acidity, basicity, and polarity arise for some amino...
Pls answer fast
Discuss how the properties of acidity, basicity, and polarity arise for some amino acids. 8. How does water interact with hydrophobic and hydrophllic molecules? How does water interact with amino acid side chains, and how does this facilitate the folding of proteins? 9. Describe how amino acids are linked together to form protein chains. 10. What does the Ramachandran plot describe? How is it useful in describing protein structure? 11. What physical forces act on the amino...
Energy and entropy: When a protein folds, it is able to lower its potential energy by...
Energy and entropy: When a protein folds, it is able to lower its potential energy by making favorable electrostatic and hydrophobic/hydrophilic interactions. However, when you increase the temperature of its environment, you can cause the protein to unfold. Explain why the folded state is dependent on temperature.
Entropy _______ in the system in which a protein is formed by joining together many amino...
Entropy _______ in the system in which a protein is formed by joining together many amino acids with peptide bonds. increases stays the same increases and then decreasesto zero decreases
19. The _structure of a protein refers to the linear sequence of amino acids in that...
19. The _structure of a protein refers to the linear sequence of amino acids in that protein. 20. Make up an example of the primary structure of a protein in the space below 21. The structure of a protein refers to a regular, recurring arrangement of the amino acid chain. One such arrangement, called the occurs when the amino acid chain forms a spiral or coil. Draw an example of this structure in the space below. 22. Another type of_...
Protein folding and lipid-bilayer formation result in decreased entropy for a protein molecule and bilayer components....
Protein folding and lipid-bilayer formation result in decreased entropy for a protein molecule and bilayer components. The decrease entropy of the surrounding entropy is balanced by a large increase in the OTemperature Salt solutions Pressure Water molecules Water's ability to dissolve a wide variety of molecules is important, but more important is the hydrophobic effect, which drives the aggregation of nonpolar molecules and plays a role in the folding of proteins and formation of lipid bilayers. What forces drive the...
A chain GIVEQCCASVCSLYQLENYCN B chain FVNQHLCGSHLVEALYLVCGERGFFYTPKA Shown above is the amino acid sequence of the hormone...
A chain GIVEQCCASVCSLYQLENYCN B chain FVNQHLCGSHLVEALYLVCGERGFFYTPKA Shown above is the amino acid sequence of the hormone insulin. This structure was determined by Frederick Sanger and his coworkers. Most of this work is described in a series of articles published in the Biochemical Journal from 1945 to 1955. When Sanger and colleagues began their work in 1945, it was known that insulin was a small protein consisting of two or four polypeptide chains linked by disulfide bonds. Sanger and his coworkers...
The pK of the side chain of amino acid X in a polypeptide is normally in...
The pK of the side chain of amino acid X in a polypeptide is normally in the range of 9-10 and carries a positive charge when protonated. Suppose you have a soluble globular protein and you find there is an X that has a pK of 6.5. What is the most likely reason for such a large drop in pK? Circle the correct answer. a) X is on the surface of the protein where it ion pairs with the carboxylate...
how does the protein environment surrounding an amino acid chain affect its chemical properties?Consider the carboxyl...
how does the protein environment surrounding an amino acid chain affect its chemical properties?Consider the carboxyl group on an asparate side chain in the following environments in a protein. Rank in order these environments from the highest to the lowest proportion of carboxyl groups in the -COO- form.that is in terms of pKas. 1. an aspartate side chain on the surface of protein with no other ionizable groups nearby. 2. an aspartate side chain buried in a hydrophobic pocket on...
Consider the properties of NaOH. Identify by name an amino acid residue whose side chain might...
Consider the properties of NaOH. Identify by name an amino acid residue whose side chain might be chemically changed when NaOH is added to the protein. Write the chemical equation for the chemical reaction that occurs when said reagent reacts with the side chain functional group of this specific amino acid. Remember that the control is dissolved in pH 7 phosphate buffer.
Do you expect a Pro→Gly mutation in a surface-loop region of a globular protein to be stabilizing or destabilizing? Assu...
Do you expect a Pro→Gly mutation in a surface-loop region of a
globular protein to be stabilizing or destabilizing? Assume the
mutant folds to a native-like conformation. Explain your answer in
terms of the predicted enthalpic and entropic
effects of the mutation on the ΔG for protein folding compared to
ΔG of folding for the wild-type protein.
Match the items in the left column to the appropriate blanks in
the sentences on the right.
ASsolvent Because the mutation is on...
Pls answer fast
Discuss how the properties of acidity, basicity, and polarity arise for some amino acids. 8. How does water interact with hydrophobic and hydrophllic molecules? How does water interact with amino acid side chains, and how does this facilitate the folding of proteins? 9. Describe how amino acids are linked together to form protein chains. 10. What does the Ramachandran plot describe? How is it useful in describing protein structure? 11. What physical forces act on the amino...
19. The _structure of a protein refers to the linear sequence of amino acids in that protein. 20. Make up an example of the primary structure of a protein in the space below 21. The structure of a protein refers to a regular, recurring arrangement of the amino acid chain. One such arrangement, called the occurs when the amino acid chain forms a spiral or coil. Draw an example of this structure in the space below. 22. Another type of_...
Protein folding and lipid-bilayer formation result in decreased entropy for a protein molecule and bilayer components. The decrease entropy of the surrounding entropy is balanced by a large increase in the OTemperature Salt solutions Pressure Water molecules Water's ability to dissolve a wide variety of molecules is important, but more important is the hydrophobic effect, which drives the aggregation of nonpolar molecules and plays a role in the folding of proteins and formation of lipid bilayers. What forces drive the...
A chain GIVEQCCASVCSLYQLENYCN B chain FVNQHLCGSHLVEALYLVCGERGFFYTPKA Shown above is the amino acid sequence of the hormone insulin. This structure was determined by Frederick Sanger and his coworkers. Most of this work is described in a series of articles published in the Biochemical Journal from 1945 to 1955. When Sanger and colleagues began their work in 1945, it was known that insulin was a small protein consisting of two or four polypeptide chains linked by disulfide bonds. Sanger and his coworkers...
Do you expect a Pro→Gly mutation in a surface-loop region of a
globular protein to be stabilizing or destabilizing? Assume the
mutant folds to a native-like conformation. Explain your answer in
terms of the predicted enthalpic and entropic
effects of the mutation on the ΔG for protein folding compared to
ΔG of folding for the wild-type protein.
Match the items in the left column to the appropriate blanks in
the sentences on the right.
ASsolvent Because the mutation is on...
Most questions answered within 3 hours.
-
Where is the error in this code sequence?
String s1 = "Hello";
String s2 = "ello";...
asked 11 months ago -
Financial data for Joel de Paris, Inc., for last year
follow:
Joel de Paris, Inc.
Balance...
asked 11 months ago -
Consider this reaction:
Al2(SO4)3 (aq)+ BaCl3
(aq) Al2Cl6 (aq)- +
3BaSO4(s) . What is the...
asked 11 months ago -
Suppose that Savneet is considering increasing her
recent random sample from 20 car rentals to 40...
asked 11 months ago -
Trucks arrive at an unloading terminal at an average rate of 120
per hour.
Trucks arrive...
asked 11 months ago -
Why are methanol and ethanol completely soluble in water while
octanol is not very little soluble....
asked 11 months ago -
A facilities manager at a university reads in a research report
that the mean amount of...
asked 11 months ago -
When the CuSO4 is rehydrated by adding water to the anhydrous
compound, is this an endothermic...
asked 11 months ago -
A ray of sunlight is passing from diamond into crown glass; the
angle of incidence is...
asked 11 months ago -
A block of mass 0.249 kg is placed on top of a light, vertical
spring of...
asked 11 months ago -
how do the kidneys compensate in the presences of acidosis
a) trigger hyperventilate
b) reserve acid...
asked 11 months ago -
Question 501 pts
The rental rate of capital to the firm increases. Which of the
following...
asked 11 months ago