Consider the properties of NaOH. Identify by name an amino acid residue whose side chain might...
Consider the properties of NaOH. Identify by name an amino acid residue whose side chain might be chemically changed when NaOH is added to the protein. Write the chemical equation for the chemical reaction that occurs when said reagent reacts with the side chain functional group of this specific amino acid. Remember that the control is dissolved in pH 7 phosphate buffer.
Homework Answers
NaOH is a strong base and so
it will react with any acidic compound. Therefore, the amino acids
which are acidic in nature will react with NaOH to loss their
acidic proton and converted to Sodium salt of that amino acid.
Examples of acidic amino acids are glutamic acid and aspartic acid. These amino acids reacts with NaOH to give sodium salt of these amino acids.
Structures and reactions are given in the attached picture.
Add Answer to:
Consider the properties of NaOH. Identify by name an amino acid
residue whose side chain might...
3. Look at your plot of the data. Which of the four reagents was the most effective at denaturing...
#4 the reagnet is HCl
3. Look at your plot of the data. Which of the four reagents was the most effective at denaturing protein-chromophore complex? Justify your answer. 12 pts] e lon Hc1 was the most effective. This is because it is aston a cid, whrin esuited in the qrcatest ratt of denatoratianc to the othex denaturants. Consider the chemical chain might be chemically changed when the reagent identifned in #3 ts added to the protein. Write properties of...
how does the protein environment surrounding an amino acid chain affect its chemical properties?Consider the carboxyl...
how does the protein environment surrounding an amino acid chain affect its chemical properties?Consider the carboxyl group on an asparate side chain in the following environments in a protein. Rank in order these environments from the highest to the lowest proportion of carboxyl groups in the -COO- form.that is in terms of pKas. 1. an aspartate side chain on the surface of protein with no other ionizable groups nearby. 2. an aspartate side chain buried in a hydrophobic pocket on...
The pK of the side chain of amino acid X in a polypeptide is normally in...
The pK of the side chain of amino acid X in a polypeptide is normally in the range of 9-10 and carries a positive charge when protonated. Suppose you have a soluble globular protein and you find there is an X that has a pK of 6.5. What is the most likely reason for such a large drop in pK? Circle the correct answer. a) X is on the surface of the protein where it ion pairs with the carboxylate...
Consider a protein with the acidic side chains, Amino Acid side-chain Arginine pKa = 12.48 Aspartic...
Consider a protein with the acidic side chains, Amino Acid side-chain Arginine pKa = 12.48 Aspartic Acid PKa = 3.90 Cysteine pKa = 8.33 Glutamic acid pKa = 4.07 Histidine pKa = 6.04 Lysine pKa =10.79 Tyrosine pKa =10.13 Given that the pH of blood is about 7.3, how many of the above side chains would be mostly in their ionic form (A-) in blood? 2 3 4 5
A chain GIVEQCCASVCSLYQLENYCN B chain FVNQHLCGSHLVEALYLVCGERGFFYTPKA Shown above is the amino acid sequence of the hormone...
A chain GIVEQCCASVCSLYQLENYCN B chain FVNQHLCGSHLVEALYLVCGERGFFYTPKA Shown above is the amino acid sequence of the hormone insulin. This structure was determined by Frederick Sanger and his coworkers. Most of this work is described in a series of articles published in the Biochemical Journal from 1945 to 1955. When Sanger and colleagues began their work in 1945, it was known that insulin was a small protein consisting of two or four polypeptide chains linked by disulfide bonds. Sanger and his coworkers...
10) Would an amino acid with the given side chain be most likely found in the hydrophobic or hydrophilic region of a pr...
10) Would an amino acid with the given side chain be most likely found in the hydrophobic or hydrophilic region of a protein? -CH-CH3 он CH2-CH-CH3 он CH3 11) What process occurs when heat, acids, bases, and heavy metal ions cause loss of biological function of a protein? 12) Answer the following questions regarding enzyme activity: a) The optimum temperature and pH for most biological enzymes is b) The molecules to which an enzyme binds are called the c) The...
QUESTION 13 What chemical group is at the end of an amino acid chain corresponding to...
QUESTION 13 What chemical group is at the end of an amino acid chain corresponding to the 3' end of the mRNA molecule? A. Peptide bond B.5 phosphate group C.3" hydroxyl group D. Amino (N-terminus) E. Carboxyl (C-terminus) QUESTION 14 Which of the following is true regarding pre-mRNA modifications/processing? O A. Alternative splicing allows for increased complexity and synthesis of protein isomers OB. The 5' cap is added after RNA polymerase dissociates from the gene OC. The poly A tail...
The following is an example of an O-linked oligosaccharide chain in oligosaccharide is linked to the protein by the side-chain functional B the side-chain functional group of serine or thre...
The following is an example of an O-linked oligosaccharide chain in oligosaccharide is linked to the protein by the side-chain functional B the side-chain functional group of serine or threonine residues. Fuda2-12) Gal(β1-34)GlcNAc(B1-4) aride chain in glycoproteins. The O-linkage means the GlcNAc(a1 )-) Serine GalNAc(al>3) al(B1- 4)GIcNAc(B13) Gal(B1->4)GIcNAc(3)G1>3) Fuc(a22) Draw out this polymer from the following Fischer projections of the monosaccharide. 1) Show each monosaccharide in the Haworth projection and in the Chair conformation for the six-member rings. 2) Show...
COLOR 2 mlogg albumen 2 mL. honey 2 ml. amino acid solution 2 mL. distilled water...
COLOR 2 mlogg albumen 2 mL. honey 2 ml. amino acid solution 2 mL. distilled water 2 mL. peosein solution bWhich contains more protein (C-N bonds), egg albu- men or honey? How can you tell? Amino acid Amino ackd e. Do free amino acids have peptide bonds? d. What are the functions of proteins in living organisms? но HOH O Polypeptide chain Figure 6.7 A peptide bond joins two amino acids, and pepside bonds link mmany amino acids to form...
1. Four elements make up 96% of the molecules involved chemical a) Oxygen, (0), b) Nitrogen...
1. Four elements make up 96% of the molecules involved chemical a) Oxygen, (0), b) Nitrogen (N), c) Carbon (C), d) Hydrogen (H) Ne in chemical evolution. Which of the following is not one of these? 2. During Chemical Evolution, elements reacted with each other to form sl norga compounds is thought to have been a critical solvent for elements and simple molec Oxygen ef Water molecules? a) Formaldehyde b) Carbon dloxide c) Ammonia d lipid bilayer was important because:...
#4 the reagnet is HCl
3. Look at your plot of the data. Which of the four reagents was the most effective at denaturing protein-chromophore complex? Justify your answer. 12 pts] e lon Hc1 was the most effective. This is because it is aston a cid, whrin esuited in the qrcatest ratt of denatoratianc to the othex denaturants. Consider the chemical chain might be chemically changed when the reagent identifned in #3 ts added to the protein. Write properties of...
A chain GIVEQCCASVCSLYQLENYCN B chain FVNQHLCGSHLVEALYLVCGERGFFYTPKA Shown above is the amino acid sequence of the hormone insulin. This structure was determined by Frederick Sanger and his coworkers. Most of this work is described in a series of articles published in the Biochemical Journal from 1945 to 1955. When Sanger and colleagues began their work in 1945, it was known that insulin was a small protein consisting of two or four polypeptide chains linked by disulfide bonds. Sanger and his coworkers...
10) Would an amino acid with the given side chain be most likely found in the hydrophobic or hydrophilic region of a protein? -CH-CH3 он CH2-CH-CH3 он CH3 11) What process occurs when heat, acids, bases, and heavy metal ions cause loss of biological function of a protein? 12) Answer the following questions regarding enzyme activity: a) The optimum temperature and pH for most biological enzymes is b) The molecules to which an enzyme binds are called the c) The...
QUESTION 13 What chemical group is at the end of an amino acid chain corresponding to the 3' end of the mRNA molecule? A. Peptide bond B.5 phosphate group C.3" hydroxyl group D. Amino (N-terminus) E. Carboxyl (C-terminus) QUESTION 14 Which of the following is true regarding pre-mRNA modifications/processing? O A. Alternative splicing allows for increased complexity and synthesis of protein isomers OB. The 5' cap is added after RNA polymerase dissociates from the gene OC. The poly A tail...
The following is an example of an O-linked oligosaccharide chain in oligosaccharide is linked to the protein by the side-chain functional B the side-chain functional group of serine or threonine residues. Fuda2-12) Gal(β1-34)GlcNAc(B1-4) aride chain in glycoproteins. The O-linkage means the GlcNAc(a1 )-) Serine GalNAc(al>3) al(B1- 4)GIcNAc(B13) Gal(B1->4)GIcNAc(3)G1>3) Fuc(a22) Draw out this polymer from the following Fischer projections of the monosaccharide. 1) Show each monosaccharide in the Haworth projection and in the Chair conformation for the six-member rings. 2) Show...
COLOR 2 mlogg albumen 2 mL. honey 2 ml. amino acid solution 2 mL. distilled water 2 mL. peosein solution bWhich contains more protein (C-N bonds), egg albu- men or honey? How can you tell? Amino acid Amino ackd e. Do free amino acids have peptide bonds? d. What are the functions of proteins in living organisms? но HOH O Polypeptide chain Figure 6.7 A peptide bond joins two amino acids, and pepside bonds link mmany amino acids to form...
1. Four elements make up 96% of the molecules involved chemical a) Oxygen, (0), b) Nitrogen (N), c) Carbon (C), d) Hydrogen (H) Ne in chemical evolution. Which of the following is not one of these? 2. During Chemical Evolution, elements reacted with each other to form sl norga compounds is thought to have been a critical solvent for elements and simple molec Oxygen ef Water molecules? a) Formaldehyde b) Carbon dloxide c) Ammonia d lipid bilayer was important because:...
Most questions answered within 3 hours.
-
Where is the error in this code sequence?
String s1 = "Hello";
String s2 = "ello";...
asked 10 months ago -
Financial data for Joel de Paris, Inc., for last year
follow:
Joel de Paris, Inc.
Balance...
asked 10 months ago -
Consider this reaction:
Al2(SO4)3 (aq)+ BaCl3
(aq) Al2Cl6 (aq)- +
3BaSO4(s) . What is the...
asked 10 months ago -
Suppose that Savneet is considering increasing her
recent random sample from 20 car rentals to 40...
asked 10 months ago -
Trucks arrive at an unloading terminal at an average rate of 120
per hour.
Trucks arrive...
asked 10 months ago -
Why are methanol and ethanol completely soluble in water while
octanol is not very little soluble....
asked 10 months ago -
A facilities manager at a university reads in a research report
that the mean amount of...
asked 10 months ago -
When the CuSO4 is rehydrated by adding water to the anhydrous
compound, is this an endothermic...
asked 10 months ago -
A ray of sunlight is passing from diamond into crown glass; the
angle of incidence is...
asked 10 months ago -
A block of mass 0.249 kg is placed on top of a light, vertical
spring of...
asked 10 months ago -
how do the kidneys compensate in the presences of acidosis
a) trigger hyperventilate
b) reserve acid...
asked 10 months ago -
Question 501 pts
The rental rate of capital to the firm increases. Which of the
following...
asked 10 months ago