What is the size and pI of this putative protein >XP_012347710.1 PREDICTED: E3 ubiquitin-protein ligase MARCH8...
-
What is the size and pI of this putative protein
>XP_012347710.1 PREDICTED: E3 ubiquitin-protein ligase MARCH8 [Apis florea]
MPVHQINVNPPDRQPPLSLGSSNNNSPAGGEGLPEWTSKESTYPTVVTIIPDHYHSSVSTLSSSNDICRI
CHCEGEEGAPLLAPCYCSGSLRYVHQACLQQWIKASDTRACELCKFTFIMHAKTKPFCEWEKLEMSALEV
RKLWCAVAFHAVAALCVAWSLYVLVERSVEEARRGYVDWSFWTKLIVVVIGSTGGLVFMYIQCKVYITLC
RKWRAFNRVIFIQNAPEKVVLPPSPTDSLREVTLPLKDPTASMPELNHSLLPCNIDPPCASQMVKPDSAA
PPQRHDAQLKLYVFDKLSSSEDNL
Homework Answers
Add Answer to:
What is the size and pI of this putative protein
>XP_012347710.1 PREDICTED: E3 ubiquitin-protein ligase MARCH8...
Phosphorylation-dependent binding of F-box protein B-TrCP containing E3 ubiquitin ligase to human WEE1A. S123 is phosphorylated...
Phosphorylation-dependent binding of F-box protein B-TrCP containing E3 ubiquitin ligase to human WEE1A. S123 is phosphorylated by a CDK and the phosphorylation primes CK2 to phosphorylate S121 resulting in creation of a B-TCP phosphodegron (EEGFGpS121) that is responsible for the instability of WEE1A during interphase. At the onset of M-phase, when activated Plk1 accumulates, Plk1 binds to WEE1A to the PBD binding motif surrounding PS123 (SpSP) via its PBD and phosphorylates S53 resulting in generation of the second phosphodegron (DpSAFQE)....
What is ubiquitin ligase? A) The enzyme that transfers ubiquitin onto the 20S subunit from the...
What is ubiquitin ligase? A) The enzyme that transfers ubiquitin onto the 20S subunit from the protein destined for degradation. B) The enzyme that removes ubiquitin from proteins in the proteasome. C) The enzyme that transfers ubiquitin onto proteins that are destined for degradation.
Question 3 1 pts What protein must bind to the ORC complex in order to induce...
Question 3 1 pts What protein must bind to the ORC complex in order to induce DNA replication? Ubiquitin O p27 O Cyclin A Cdc25
A. What is the Isoelectric point pI of the peptide Gly-Glu-Ala-Lys-Val ? B. A purified protein...
A. What is the Isoelectric point pI of the peptide Gly-Glu-Ala-Lys-Val ? B. A purified protein is in a Hepes buffer at pH 7 with 300 mM NaCl. A sample (2mL) of the protein solution is placed in a tube made of dialysis membrane and dialyzed against 1 L of the same Hepes buffer with no NaCl. Small molecules and ions (such as Na+, Cl-, and Hepes) can diffuse across the dialysis membrane, but the protein cannot. 1. Once the...
You have a mixture of the proteins listed below. Protein pI Molecular Weight (kDa) A 3.1...
You have a mixture of the proteins listed below. Protein pI Molecular Weight (kDa) A 3.1 265 B 6.9 93 C 10.3 96 D 7.1 43 E 8.6 189 1. You load the protein mix onto a cation exchange column at pH 5. Next, you apply a "washing" step by passing through buffer at pH 5. Finally, for your elution step, you apply a pH gradient starting from pH 2.0 to pH 13.0. (A gradient buffer system allows you to...
a) What aspects of protein structure and folding are explained by entropy? How does entropy affect...
a) What aspects of protein structure and folding are explained
by entropy? How does entropy
affect a protein’s native versus denatured structure?
b) What aspects of protein structure and folding are explained
by enthalpy? How does enthalpy
affect a protein’s native versus denatured structure?
c) What aspects of protein structure and folding are
illustrative of equilibrium (or disequilibrium)?
1. The figure below shows the physical representation of a native protein versus a denatured protein 72 native state A-state 23 17...
How would SEC (size-exclusive chromatography) enhance (or not) for protein purification and why? What advantages or...
How would SEC (size-exclusive chromatography) enhance (or not) for protein purification and why? What advantages or disadvantages? What could be done in the future for greater purification? SEC means size-exclusive chromatography
The isoelectric point, pI, of the protein neuraminidase is 5.1, while that of asparaginase is 4.9 What is the net charge of neuraminidase at pH 3.5 What is the net charge of asparaginase at pH 4.3 Th...
The isoelectric point, pI, of the protein neuraminidase is 5.1, while that of asparaginase is 4.9 What is the net charge of neuraminidase at pH 3.5 What is the net charge of asparaginase at pH 4.3 The isoelectric point of arginine is 10.76; isoleucine , 6.02 During paper electrophoresis at pH 7.5 , toward which electrode does arginine migrate? During paper electrophoresis at pH 7.1, toward which electrode does isoleucine migrate?
The isoelectric point, pI, of the protein neuraminidase is...
In what order would the proteins elute from a size exclusion column (limit 50- 40,000)? Protein...
In what order would the proteins elute from a size exclusion column (limit 50- 40,000)? Protein Molecular weight 1- 90 KDa 2- 27,000 KDa 3- 300 KDa
A protein is purified from a bacterium using Size Exclusion Chromatography (SEC), with a molecular weight...
A protein is purified from a bacterium using Size Exclusion Chromatography (SEC), with a molecular weight of 200kD. When this protein is run on SDS-PAGE , a sing band is observed at 100kD. Based on these observations, what can be concluded about the structure of the protein? The protein consist of two 200kD subiunits The protein has a quaternary structure The protein is madeup of two 100 kD subunits Proteins is a tetramer consisting of 200 kD domains. The protein...
Phosphorylation-dependent binding of F-box protein B-TrCP containing E3 ubiquitin ligase to human WEE1A. S123 is phosphorylated by a CDK and the phosphorylation primes CK2 to phosphorylate S121 resulting in creation of a B-TCP phosphodegron (EEGFGpS121) that is responsible for the instability of WEE1A during interphase. At the onset of M-phase, when activated Plk1 accumulates, Plk1 binds to WEE1A to the PBD binding motif surrounding PS123 (SpSP) via its PBD and phosphorylates S53 resulting in generation of the second phosphodegron (DpSAFQE)....
Question 3 1 pts What protein must bind to the ORC complex in order to induce DNA replication? Ubiquitin O p27 O Cyclin A Cdc25
a) What aspects of protein structure and folding are explained
by entropy? How does entropy
affect a protein’s native versus denatured structure?
b) What aspects of protein structure and folding are explained
by enthalpy? How does enthalpy
affect a protein’s native versus denatured structure?
c) What aspects of protein structure and folding are
illustrative of equilibrium (or disequilibrium)?
1. The figure below shows the physical representation of a native protein versus a denatured protein 72 native state A-state 23 17...
The isoelectric point, pI, of the protein neuraminidase is 5.1, while that of asparaginase is 4.9 What is the net charge of neuraminidase at pH 3.5 What is the net charge of asparaginase at pH 4.3 The isoelectric point of arginine is 10.76; isoleucine , 6.02 During paper electrophoresis at pH 7.5 , toward which electrode does arginine migrate? During paper electrophoresis at pH 7.1, toward which electrode does isoleucine migrate?
The isoelectric point, pI, of the protein neuraminidase is...
Most questions answered within 3 hours.
-
Where is the error in this code sequence?
String s1 = "Hello";
String s2 = "ello";...
asked 11 months ago -
Financial data for Joel de Paris, Inc., for last year
follow:
Joel de Paris, Inc.
Balance...
asked 11 months ago -
Consider this reaction:
Al2(SO4)3 (aq)+ BaCl3
(aq) Al2Cl6 (aq)- +
3BaSO4(s) . What is the...
asked 11 months ago -
Suppose that Savneet is considering increasing her
recent random sample from 20 car rentals to 40...
asked 11 months ago -
Trucks arrive at an unloading terminal at an average rate of 120
per hour.
Trucks arrive...
asked 11 months ago -
Why are methanol and ethanol completely soluble in water while
octanol is not very little soluble....
asked 11 months ago -
A facilities manager at a university reads in a research report
that the mean amount of...
asked 11 months ago -
When the CuSO4 is rehydrated by adding water to the anhydrous
compound, is this an endothermic...
asked 11 months ago -
A ray of sunlight is passing from diamond into crown glass; the
angle of incidence is...
asked 11 months ago -
A block of mass 0.249 kg is placed on top of a light, vertical
spring of...
asked 11 months ago -
how do the kidneys compensate in the presences of acidosis
a) trigger hyperventilate
b) reserve acid...
asked 11 months ago -
Question 501 pts
The rental rate of capital to the firm increases. Which of the
following...
asked 11 months ago