Question

What is ubiquitin ligase? A) The enzyme that transfers ubiquitin onto the 20S subunit from the...

What is ubiquitin ligase?

A) The enzyme that transfers ubiquitin onto the 20S subunit from the protein destined for degradation.

B) The enzyme that removes ubiquitin from proteins in the proteasome.

C) The enzyme that transfers ubiquitin onto proteins that are destined for degradation.

0 0
Add a comment Improve this question Transcribed image text
Answer #1

Answer: (C)

Explanation: Ubiquitination, a post-translational modification of proteins requires the sequential action of three enzymes. E1, or ubiquitin-activating enzyme, catalyzes the ATP-dependent activation of ubiquitin. Ubiquitin is then transferred to a E2 (ubiquitin-conjugating enzymes) and through the E3 (ubiquitin ligase) to the protein substrate destined for degradation by the proteasome.

E3 (ubiquitin ligase) recognize a substrate through specific short amino acid sequences, known as degrons, and catalyze the transfer of ubiquitin from the E2 to the protein substrate.

.

If you like my answer, please do not forget to thumbs up. I would be happy to discuss your concerns in the comment section below. Thank you!

Add a comment
Know the answer?
Add Answer to:
What is ubiquitin ligase? A) The enzyme that transfers ubiquitin onto the 20S subunit from the...
Your Answer:

Post as a guest

Your Name:

What's your source?

Earn Coins

Coins can be redeemed for fabulous gifts.

Not the answer you're looking for? Ask your own homework help question. Our experts will answer your question WITHIN MINUTES for Free.
Similar Homework Help Questions
  • Phosphorylation-dependent binding of F-box protein B-TrCP containing E3 ubiquitin ligase to human WEE1A. S123 is phosphorylated...

    Phosphorylation-dependent binding of F-box protein B-TrCP containing E3 ubiquitin ligase to human WEE1A. S123 is phosphorylated by a CDK and the phosphorylation primes CK2 to phosphorylate S121 resulting in creation of a B-TCP phosphodegron (EEGFGpS121) that is responsible for the instability of WEE1A during interphase. At the onset of M-phase, when activated Plk1 accumulates, Plk1 binds to WEE1A to the PBD binding motif surrounding PS123 (SpSP) via its PBD and phosphorylates S53 resulting in generation of the second phosphodegron (DpSAFQE)....

  • In your biotechnology class your team is given the project of increasing the life span of...

    In your biotechnology class your team is given the project of increasing the life span of an agriculturally important organism. Your team-mate suggests feeding the organism a drug that inhibits the proteasome, because protein degradation is wasteful of energy, and if we could reduce protein degradation then protein accumulation, growth, and life span would be enhanced. Given what you know about how cells handle proteins, is this likely to be a good approach to increasing longevity? Only one answer is...

  • What is the size and pI of this putative protein >XP_012347710.1 PREDICTED: E3 ubiquitin-protein ligase MARCH8...

    What is the size and pI of this putative protein >XP_012347710.1 PREDICTED: E3 ubiquitin-protein ligase MARCH8 [Apis florea] MPVHQINVNPPDRQPPLSLGSSNNNSPAGGEGLPEWTSKESTYPTVVTIIPDHYHSSVSTLSSSNDICRI CHCEGEEGAPLLAPCYCSGSLRYVHQACLQQWIKASDTRACELCKFTFIMHAKTKPFCEWEKLEMSALEV RKLWCAVAFHAVAALCVAWSLYVLVERSVEEARRGYVDWSFWTKLIVVVIGSTGGLVFMYIQCKVYITLC RKWRAFNRVIFIQNAPEKVVLPPSPTDSLREVTLPLKDPTASMPELNHSLLPCNIDPPCASQMVKPDSAA PPQRHDAQLKLYVFDKLSSSEDNL

  • QUESTION 25 The concentration of mitotic cyclin ____________________. A. is highest in G1 phase B. decreases...

    QUESTION 25 The concentration of mitotic cyclin ____________________. A. is highest in G1 phase B. decreases at the end of M phase as a result of ubiquitylation and degradation C. decreases at the prophase D. is controlled by phosphorylation QUESTION 26 Which of the following statements about the ubiquitin-proteasome pathway is false? A. Proteases, which reside in the central cylinder of a proteasome, degrade the ubiquitin-modified protein. B. Ubiquitin is a small protein that is non-covalently attached to proteins to...

  • ERAD, or ER associated degradation, is a quality control measure with the following function: A. misfolded...

    ERAD, or ER associated degradation, is a quality control measure with the following function: A. misfolded proteins activate the expression of genes such as chaperones that will help to refold and stabilize misfolded proteins until the fold correctly B. misfolded proteins are ubiquitinated and degraded by proteeasomes inside the ER C. by recognizing the structure of carbohydrates attached to proteins in the ER, incorrectly folded proteins are retained in the ER, allowing for multiple cycles of refolding, proteins that cannot...

  • A dimeric enzyme, glucokinase, has a binding site for glucose in each subunit. The KD for...

    A dimeric enzyme, glucokinase, has a binding site for glucose in each subunit. The KD for the fi rst binding event is 1 mM and the KD for the second event is 10 μM. a. What is the Hill coefficient? b. Is this protein positively or negatively cooperative with respect to glucose binding

  • The GTPase Dynamin is involved in which step of vesicular A) Binding of cargo molecules to...

    The GTPase Dynamin is involved in which step of vesicular A) Binding of cargo molecules to cargo receptors B) Assembly of the Clathrin coat C) Pinching off the vesicle from the membrane D) Transport of vesicles along microtubules Which of the following events does not occur in the rough endoplasmic reticulum? A) Cleavage of the signal peptide by the signal peptidase B) Binding of chaperone proteins to misfolded or partially folded pathways C) Transfer of a pre formed oligosaccharide to...

  • please answer all parts 106. What process helps compact the DNA in a chromosome? A) anaphase...

    please answer all parts 106. What process helps compact the DNA in a chromosome? A) anaphase promoting complex B) entry into S-phase of the cell cycle C) removal of the nuclear lamina D) removal of methyl groups from DNA E) histone de-acetylation 107. What does DNA Ligase do? A) removes mismatched nucleotides B) adds complimentary bases to single stranded DNA C) joins the ends of chromosomes together D) forms a phosphodiester covalent bond between adjacent nucleotides E) chews up single...

  • 1.) If we mix two restriction fragments cut with the same restriction enzyme in the presence of DNA ligase, ATP and appropriate buffer, we will obtain... A) protein B) carbohydrate C) recombinant DNA...

    1.) If we mix two restriction fragments cut with the same restriction enzyme in the presence of DNA ligase, ATP and appropriate buffer, we will obtain... A) protein B) carbohydrate C) recombinant DNA or plasmid D) pAMP

  • Part A The sigma (?) subunit binds to the core RNA polymerase enzyme. The function of...

    Part A The sigma (?) subunit binds to the core RNA polymerase enzyme. The function of this sigma factor is to recognize and bind to the promoter of a gene so that transcription can be initiated. The closeup shows the secondary structure of the sigma (?) subunit, which consists of four domains. Identify the domains labeled 1-3. The sigma (?) subunit binds to the core RNA polymerase enzyme. The function of this sigma factor is to recognize and bind to...

ADVERTISEMENT
Free Homework Help App
Download From Google Play
Scan Your Homework
to Get Instant Free Answers
Need Online Homework Help?
Ask a Question
Get Answers For Free
Most questions answered within 3 hours.
ADVERTISEMENT
ADVERTISEMENT