Question

Proteins have different levels of structure. Insulin contains two distinct molecules named chain A and chain...

Proteins have different levels of structure. Insulin contains two distinct molecules named chain A and chain B. If we disrupt the disulfide bonds holding the chains together, which level of structure are we interrupting?

1

2

3

4

0 0
Add a comment Improve this question Transcribed image text
Know the answer?
Add Answer to:
Proteins have different levels of structure. Insulin contains two distinct molecules named chain A and chain...
Your Answer:

Post as a guest

Your Name:

What's your source?

Earn Coins

Coins can be redeemed for fabulous gifts.

Not the answer you're looking for? Ask your own homework help question. Our experts will answer your question WITHIN MINUTES for Free.
Similar Homework Help Questions
  • 35. Insulin is a polypeptide hormone that contains two short polypeptide chains linked by two interstrand disulfide...

    35. Insulin is a polypeptide hormone that contains two short polypeptide chains linked by two interstrand disulfide bonds. In order to sequence the polypeptide chains, the most logical order of events to perform would be: I: Reduce the peptides with mercaptoethanol. II: Sequence the peptides using Edman degradation. III: Separate the peptides by gel filtration. IV: Alkylate the peptides with iodoacetate a) I, IV, III, I 36. Which ONE of the following statements regarding chaperonin is INCORRECT? The majority of...

  • A chain GIVEQCCASVCSLYQLENYCN B chain FVNQHLCGSHLVEALYLVCGERGFFYTPKA Shown above is the amino acid sequence of the hormone...

    A chain GIVEQCCASVCSLYQLENYCN B chain FVNQHLCGSHLVEALYLVCGERGFFYTPKA Shown above is the amino acid sequence of the hormone insulin. This structure was determined by Frederick Sanger and his coworkers. Most of this work is described in a series of articles published in the Biochemical Journal from 1945 to 1955. When Sanger and colleagues began their work in 1945, it was known that insulin was a small protein consisting of two or four polypeptide chains linked by disulfide bonds. Sanger and his coworkers...

  • 1.. How many different molecules are there with distinct properties with the molecular formula C2H5F? (Hint:...

    1.. How many different molecules are there with distinct properties with the molecular formula C2H5F? (Hint: Draw a lewis structure. Consider if the C-C bond can rotate) Group of answer choices A. 1 B. 2 C. 4 D. 3 2.. How many different molecules are there with distinct properties with the molecular formula C2H2F2?  (Hint: Draw a lewis structure. Consider if the C-C bond can rotate) Group of answer choices A. 2 B. 3 C. 1 D. 4 3.. Which statement...

  • 5. Which of the following molecules form complex structures linked by covalent bonds through Lys, HyLys,...

    5. Which of the following molecules form complex structures linked by covalent bonds through Lys, HyLys, or His residues? A) Collagen B) Alpha keratin C) Hemoglobin D) Myoglobin E) Beta barrels 6. Which of the following correlates to the classic experiment demonstrating that reduced and denatured RNase A could refold into the native form? A) Disulfide bonds do not stabilize folded proteins B) Reducing agents denature proteins C) 1° structure can determine 3° structure D) Urea cleaves disulfide bonds E)...

  • 26. Which of the following classification does not match the amino acid side chain A) Contains an basic group/ lysi...

    26. Which of the following classification does not match the amino acid side chain A) Contains an basic group/ lysine B) It is polar C) Forms disulfide bond/ cysteine D) Forms hydrogen bonds with neighbors/ alanine serine 27. All amino acids found in proteins are L-amino acids EXCEPT the achiral. A) glutamate B) Lysine C) glyeine D) Alamine 28. The plH at which the positive and negative charges of an amino acid balance each ofher is called the A) isotonic...

  • Distinguish between the Different levels of Protein Structure, Induding Primary, Secondary. Tertiary and Quaternary Question Which...

    Distinguish between the Different levels of Protein Structure, Induding Primary, Secondary. Tertiary and Quaternary Question Which of the following types of connections maintain the primary structure of a protein? Select all that apply hydrophobic interactions hydrogen bonds peptide bonds disulfide bonds FEEDBACK MORE INSTRUCTIO Activity Details ✓ You have viewed this op Visited Oct 3, 2019 11:12 PM Ota 35N

  • 20 Marks) Question 3 a) The structure of proteins is described at four levels: primary, secondary,...

    20 Marks) Question 3 a) The structure of proteins is described at four levels: primary, secondary, tertiary and quaternary Briefly explain what is referred to by each of these terms. Why are these distinctions useful? [5 marks] b) Each level of protein structure is stabilised by chemical bonds and interactions: List the bonds and/or effects primarily responsible for stabilising each level of structure. [5 marks] c) The illustration below shows a molecule of haemoglobin. Describe TWO (2) aspects of haemoglobin...

  • 1.Under anaerobic conditions pyruvate is converted to acetly CoA True or false? 2.Expect for glycine, all...

    1.Under anaerobic conditions pyruvate is converted to acetly CoA True or false? 2.Expect for glycine, all of the amino acids in a protein have the D configuration. True or false? 3.The side chain of the amino acid lysine is -CH2-CH2-CH2-CH2-NH2. TO which category does this amino acid belong? 4. which statment below describes the primary structure of a protien? - peptide bonds join amino acids in a polypeptide chain? - two polypeptide chains are held together by hydrogen bonds and...

  • Do you think it is possible to exploit the biological process of protein synthesis to make...

    Do you think it is possible to exploit the biological process of protein synthesis to make human proteins in the lab? What would you need to do this? Describe the general process you would need to follow to accomplish this goal. NATIONAL CENTER FOR CASE STUDY TEACHING IN SCIENCE Part lIl Chemical Synthesis of Human Insulin - Close, but no Cigar In order to meet the increasing demands for insulin, and to eliminate the adverse side effects of animal insulin,...

  • 13. For secondary structure, the two major possible arrangements of the peptide chain and are 14. The structure def...

    13. For secondary structure, the two major possible arrangements of the peptide chain and are 14. The structure defines the 3-dimensional shape of the compact structure of the peptide of a protein. 15. Not all proteins have a. primary structure b. secondary structu re c. tertiary structure d. quatemary structure 16. Bonds between sulfur groups on the amino acid(s) the protein structure and would be classified as can stabilize structure. 17. True/False Enzymes catalyze processes, meaning that they improve the...

ADVERTISEMENT
Free Homework Help App
Download From Google Play
Scan Your Homework
to Get Instant Free Answers
Need Online Homework Help?
Ask a Question
Get Answers For Free
Most questions answered within 3 hours.
ADVERTISEMENT
ADVERTISEMENT