Question

NATIONAL CENTER FOR CASE STUDY TEACHING IN SCIENCE Part lIl Chemical Synthesis of Human Insulin - Close, but no Cigar In order to meet the increasing demands for insulin, and to eliminate the adverse side effects of animal insulin, scientists began searching for ways to synthesize human insulin in the hrSr lab. The first attempts to produce synthetic human insulin 2 3 459101112 13 14151617 1819 20 21 made use of chemical reactions to join amino acids in the correct order to make the insulin protein. Before scientists could do this, however, they needed to know the primary Chain B amino acid sequence of insulin ain Phe val Asn Gn H GlyeHi alGu laTy ays Gly The amino acid sequence of human insulin was worked out23 4 5678 9 10 11 12 13 14 15 16 17 18 19 20 by Frederick Sanger in 1951 insulin was in fact the first protein to be sequenced), and he was awarded the Nobel Prize in 1958 for his discovery. Insulin is composed of two short chains, the A chain and the B chain, which are held together by disulfide bonds or bridges between cysteine Figure 2. Amino acid sequence of human insulin. Each amino acid amino acids present in the two chains Glu 21 30 29 28 27 26 25 24 23 22 is represented by a circle. Disulfide bonds are shown by lines Human insulin was chemically synthesized in the early 1960s by several academic groups, including those at the University of Pittsburgh and Aachen University in Germany. To do this, the scientists produced the A and B chains separately by joining the amino acids in the correct order through a series of chemical reactions, and then they mixed them together so that disulfide bonds could form. While the synthetic insulin was functional, the production process was very difficult, time intensive, expensive, and could not be scaled up to produce enough insulin to meet the needs of diabetic patients Another method was used by the pharmaceutical company Novo Nordisk A/S to chemically produce human insulin in the early 1970s. Scientists first purified insulin from pigs, which only differs from human insulin by a single amino acid. They then chemically treated the porcine insulin to change that single amino acid to the human amino acid, thereby producing human insulin. Novo Nordisk A/S marketed this product as semi-synthetic human insulin However, other events that occurred during this time period led to the production of human insulin in a dramatically different and more effective way, as we shall see next. Questions at are some of the criteria a pharmaceutical company would want to meet if it is producing a drug for sale to consumers 2. How do cells make proteins? Give a general overview of the process 3. Do you think it is possible to exploit the biological process of protein synthesis to make human proteins in the lab? What would you need to do this? Describe the general process you would need to follow to accomplish this goal

Do you think it is possible to exploit the biological process of protein synthesis to make human proteins in the lab? What would you need to do this? Describe the general process you would need to follow to accomplish this goal.

0 0
Add a comment Improve this question Transcribed image text
Answer #1

With the 8ntroduction of the field of genetic engineering, it has become possible to synthesise protiens outside body in vivo.

The first gene product that was produced through genetic engineering was a protien, human insulin with the aim to treat diabetes.

A rod shaped bacteria called E. Coli is used for the synthesis of this protien. These bacteria were grown in laboratory and human insulin gene was transferred into the bacteria through recombinant DNA technology. Bacteria was able to express the gene and synthesise insulin. These bacteria are grown in bioreactors for the large scale production of insulin which is then extracted from these bioreactors, purified, processed and is finally made ready for use.

Therefore protiens can be synthesised in laboratory. The various steps involved are.

1. Finding the gene that encodes the protien to be synthesised.

2. Cutting the gene by the help of specific restriction enzymes and pasting it in a suitable vector to form.recombinant DNA.

3. This recombinant DNA is transferred into a suitable host such as E. Coli.

Now E.coli is ready to synthesise the protien.

One of the important jobs for the biotechnologist is to create the perfect environment for the cells to grow and thrive. Nutrients and oxygen must be delivered in exact quantities, the optimum temperature and pH must be maintained, and waste products must be removed.

The cells that are going to produce the protein need to be able to be grown in large amounts. Bioreactors are used to grow cells under conditions where they will make proteins. A bioreactor provides cells with all the substances they need to grow and reproduce.

Add a comment
Know the answer?
Add Answer to:
Do you think it is possible to exploit the biological process of protein synthesis to make...
Your Answer:

Post as a guest

Your Name:

What's your source?

Earn Coins

Coins can be redeemed for fabulous gifts.

Not the answer you're looking for? Ask your own homework help question. Our experts will answer your question WITHIN MINUTES for Free.
Similar Homework Help Questions
  • Lab #14 Protein Synthesis Introduction Proteins are vital for the survival of an organism. Proteins make...

    Lab #14 Protein Synthesis Introduction Proteins are vital for the survival of an organism. Proteins make enzymes and hormones which control reactions that must take place in the cell to survive.Proteins are made of basic units called amino acids. There are a total of 20 amino acids. Different proteins have different number and/or combination of amino acids. The kind of amino acid that is used when producing the protein depends on the 3-base code (codon) read from the RNA molecule...

  • Find the two other segments of the sequence among your classmates that will complete the protein....

    Find the two other segments of the sequence among your classmates that will complete the protein. For example if you have a middle segment you will need to find a beginning and an end segment. Write the entire linear order of amino acids in Part 2, Question l in your proforma, (using the single letter amino acid abbreviation). Start with the beginning segment, followed by the middle segment and lastly, the end segment. Indicate the amino (NH2) and carboxyl (COOH)...

  • A chain GIVEQCCASVCSLYQLENYCN B chain FVNQHLCGSHLVEALYLVCGERGFFYTPKA Shown above is the amino acid sequence of the hormone...

    A chain GIVEQCCASVCSLYQLENYCN B chain FVNQHLCGSHLVEALYLVCGERGFFYTPKA Shown above is the amino acid sequence of the hormone insulin. This structure was determined by Frederick Sanger and his coworkers. Most of this work is described in a series of articles published in the Biochemical Journal from 1945 to 1955. When Sanger and colleagues began their work in 1945, it was known that insulin was a small protein consisting of two or four polypeptide chains linked by disulfide bonds. Sanger and his coworkers...

  • DNA, Genes and Protein Synthesis Activity 13: Protein Synthesis is the process by which cells produce (synthesize) proteins. An overview of the process is shown in model 2 (below). Gone 2...

    DNA, Genes and Protein Synthesis Activity 13: Protein Synthesis is the process by which cells produce (synthesize) proteins. An overview of the process is shown in model 2 (below). Gone 2 Gene 1 Gene 3 DNA strand3 TRANSLATION Protein Trp Gly Model 2 ACTIVITY and QUESTIONS 1. Based on the information you can gather from model 1 complete the following sentences: a. The nucleotide Adenine (A) always pairs with the nucleotide b. The nucleotide Guanine (G) always pairs with the...

  • Sequence Comparisons Proteins called molecular chaperones (described in Chapter 4) assist in the process of protein...

    Sequence Comparisons Proteins called molecular chaperones (described in Chapter 4) assist in the process of protein folding. One class of chaperone found in organisms from bacteria to mammals is heat shock protein 90 (Hsp90). All Hsp90 chaperones contain a 10 amino acid "signature sequence," which allows for ready identification of these proteins in sequence databases. Two representations of this signature sequence are shown below. (a) In this sequence, which amino acid residues are invariant (conserved across all species)? (b) At...

  • When you drink a cup of milk, what happens to the protein in the milk after...

    When you drink a cup of milk, what happens to the protein in the milk after it has been swallowed? To describe these processes, you must be able to use the vocabulary effectively. FILL IN THE BLANKS tripeptide is the active form of a digestive enzyme in the stomach that breaks polypeptide chains into smaller acid group polypeptides. dipeptide 2. Cleavage of proteins by pepsin in the stomach results in formation of which get broken down amino acids further in...

  • 6. (4) You are trying to make a synthetic copy of a particular protein but accidentally...

    6. (4) You are trying to make a synthetic copy of a particular protein but accidentally join the amino acids together in exactly the reverse order. One of your classmates says the two proteins must be identical, and bets you $20 that your synthetic protein will have exactly the same biological activity as the original. After having read this chapter, you have no hesitation in staking your $20 that it won’t. What particular feature of a polypeptide chain makes you...

  • please help me type my introduction for my lab report. thank you!! INTRODUCTION In this section,...

    please help me type my introduction for my lab report. thank you!! INTRODUCTION In this section, you will introduce the experiment by explaining generally what you did and why you did it. This section usually starts with an examination of the literature through a library search to inform the reader about work already done on this topic. If you have never done a bibliographic database search for scientific journal articles, then you are not yet a biological sciences major (note:...

  • O ACTIVITY 5.4.1 Synthesis of a Protein: A Simulation Activity In this activity, you will be...

    O ACTIVITY 5.4.1 Synthesis of a Protein: A Simulation Activity In this activity, you will be provided with the DNA nucleotide sequence that codes for a hypothetical protein. The code will be provided to you in three fragments. You will have to tran- scribe the code into mRNA, remove an intron segment, and translate the mRNA into the protein. In addition, you will have to identify the beginning fragment the middle fragment, and the end fragment. Sequence A TCTTCCCTCCTAAACGTTCAACCGGTTCTTAATCCGC CGCCAGGGCCCCGCCCCTCAGAAGTTGGT...

  • Place these events that occur during protein synthesis in the proper sequence       -   ...

    Place these events that occur during protein synthesis in the proper sequence       -       I.       II.       III.       IV.    An aminoacyl-tRNA binds to the A site       -       I.       II.       III.       IV.    A peptide bond forms between the new amino acid and a polypeptide chain       -       I.       II.       III.       IV.   ...

ADVERTISEMENT
Free Homework Help App
Download From Google Play
Scan Your Homework
to Get Instant Free Answers
Need Online Homework Help?
Ask a Question
Get Answers For Free
Most questions answered within 3 hours.
ADVERTISEMENT
ADVERTISEMENT