1. Three DNA sequence given are as follows:
SEQUENCE A
TCTTCCCTCCTAAACGTTCAACCGGTTCTTAATCCGCCGCCAGGGCCCCGCCCCTCAGAAGTTGGT
SEQUENCE B
TCAGAGGTTTTTGCCCCGTAACAACTTGTTACAACATGGTCATAAACGTCAGAGATGGTCAATCTCTTAATGACT
SEQUENCE C
TACAAACATGTAAACACACCCTCAGTGGACCAACTCGCAACATAAACCAAACACCGCTCGCGCCGAAAAAGATATGG
2. Three given sequences split into codons are as follows:
SEQUENCE A
TCT/TCC/CTC/CTA/AAC/GTT/CAA/CCG/GTT/CTT/AAT/CCG/CCG/CCA/GGG/CCC/CGC/CCC/TCA/GAA/GTT/GGT
SEQUENCE B
TCA/GAG/GTT/TTT/GCC/CCG/TAA/CAA/CTT/GTT/ACA/ACA/TGG/TCA/TAA/ACG/TCA/GAG/ATG/GTC/AAT/CTC/TTA/ATG/ACT
SEQUENCE C
TAC/AAA/CAT/GTA/AAC/ACA/CCC/TCA/GTG/GAC/CAA/CTC/GCA/ACA/TAA/ACC/AAA/CAC/CGC/TCG/CGC/CGA/AAA/AGA/TAT/GG
3. The mRNA from the given DNA sequences in as follows:
SEQUENCE A
AGA/AGG/GAG/GAU/UUG/CAA/GUU/GGC/CAA/GAA/UUA/GGC/GGC/GGU/CCC/GGG/GCG/GGG/AGU/CUU/CAA/CCA
SEQUENCE B
AGU/CUC/CAA/AAA/CGG/GGC/UAA/GUU/GAA/CAA/UGU/UGU/ACC/AGU/AUU/UGC/AGU/CUC/UAC/CAG/UUA/GAG/AAU/UAC/UGA
SEQUENCE C
AUG/UUU/GUA/CAU/UUG/UGU/GGG/AGU/CAC/CUG/GUU/GAG/CGU/UGU/AUU/UGG/UUU/GUG/GCG/AGC/GCG/GCU/UUU/UCU/AUA/CC
3. Since sequence C is starting with codon AUG which is the start codon, sequence is the beginning sequence. Sequence B is ending with UGA which the stop codon, it is the end sequence and therefore the remaining sequence A is the middle sequence.
4. The sequence after removing the codons 24 to 66 is as follows:
AUG/UUU/GUA/CAU/UUG/UGU/GGG/AGU/CAC/CUG/GUU/GAG/CGU/UGU/AUU/UGG/UUU/GUG/GCG/AGC/GCG/GCU/UUU/UAC/CAG/UUA/GAG/AAU/UAC/UGA
5. The protein sequence from the above mRNA sequence is as follows:
Met-Phe-Val-His-Leu-Cys-Gly-Ser-His-Leu-Val-Glu-Arg-Cys-Ile-Try-Phe-Val-Ala-Thr-Arg-Ala-Phe-Try-Gln-Leu-Glu-Asn-Tyr-Stop
O ACTIVITY 5.4.1 Synthesis of a Protein: A Simulation Activity In this activity, you will be...
DNA, Genes and Protein Synthesis Activity 13: Protein Synthesis is the process by which cells produce (synthesize) proteins. An overview of the process is shown in model 2 (below). Gone 2 Gene 1 Gene 3 DNA strand3 TRANSLATION Protein Trp Gly Model 2 ACTIVITY and QUESTIONS 1. Based on the information you can gather from model 1 complete the following sentences: a. The nucleotide Adenine (A) always pairs with the nucleotide b. The nucleotide Guanine (G) always pairs with the...
Please help with 4-10!
DNA, Genes,and Protein Synthesis Activity 13: 2. The bases that interact with each other are called complementary bases. this definition and your answers to 1 complete the following: a. Thiamine (T) is the complementary base of b. Cytosine (C) is the complementary base of c. Adenine (A) is the complementary base of d. Guanine (G) is the complementary base of Based on 3. Shown below is the nucleotide sequence for one strand of a stretch of...
TranslationOverview:The purpose of this activity is to help the students to understand how replication, transcription, and translation are connected. Students will use a sequence from a bacterial gene that confers resistance to antibiotics (carbapenems). They will be asked to apply the knowledge obtained in the class lecture to (1) find the promoter in the sequence, (2) determine the amino acid sequence of a fragment of the polypeptide, (3) "reverse translate" a fragment of the polypeptide, and (4) identify mutations in...
1. Transcription occurs in the a. Nucleus. b. Ribosomes of the Rough Endoplasmic Reticulum. c. Mitochondrion. d. Cell membrane. e. Smooth Endoplasmic Reticulum. 2. The monomers of DNA and RNA are a. amino acids. b. monosaccharides. c. nucleotides. d. fatty acids. e. nucleic acids. 3. Which of the following statements regarding DNA is false? a. DNA uses the nitrogenous base uracil. b. DNA is a nucleic acid. c. One DNA molecule can include four different nucleotides in its structure. d....
Table 1B: Protein Synthesis with 2nd DNA Template Strand DNA Codons in the 2nd Template Strand mRNA Sequence (List codons) Amino Acids in the Protein **Use the Genetic Code Chart on page 217 to determine the amino acids that will be placed in the protein Questions: 19. The three letter "code words of DNA and RNA that specify amino acids are called: A. codons B. promoters C. Introns D. anticodons 20. Proteins are composed of building blocks called: A. fatty...
EXERCISE 10 PROTEIN SYNTHESIS Work with a partner to complete this exercise and answer the questions that follow. You will use the DNA strand from Exercise 8 to make the protein for which it codes. STEP 1 Review the imaginary strand of DNA below. Note the complementary base pairs. AGCAATCCGTCTTGG TCGTTAGGCAGAACC STEP 2 Draw the DNA strand separating down the middle (as in the beginning of DNA replication). STEP 3 Draw the free-floating RNA bases linking up with the top...
DNA exercises Ex. 1 Use the genetic code chart (Fig. 10.8A or the one in your LN) to translate the following mRNA sequences into amino acid sequences and answer the questions. mRNA nucleotide sequence (mRNA1) AUGGCAGACAAUAUUAAGUGA 1. What is the amino acid sequence? Mutation in the mRNA nucleotide sequence (mRNA2) AUGGCAGACCAUAUUAAGUGA 2. What is the new amino acid sequence? 3. How many bases were changed in mRNA2 compared to mRNA1? 4. What type of mutation was this? 5. How many...
Questions 11-15: Gene structure/Splicing problem. "Protein X" consists of a total of 431 amino acids. Your colleague, techniques) the a biochemist, has purified the protein and determined (via complicated and messy chemical sequence of the first 37 amino acids in the protein, which she has reported to you as follows: HN- MSNITVDDELNLSREQQGFAEDDFIVIKEERETSLSP . nwhile, you have isolated a genomic clone of the gene that codes for protein X, and determined the DNA equence of the first 227 bases from the...
1) Using the bacterial DNA sequence that the instructor gave you:a. Identify and underline the promoter region and the start codon.b. Identify the coding and template strandc. Transcribe the coding sequenced. Translate the mRNA sequence8) Which of the following mutational changes would you predict to be the most deleterious to gene function? Explain your answers.a. Insertion of a single nucleotide near the end of the coding sequence.b. Removal of a single nucleotide near the beginning of the coding sequence.c. Deletion...
Lab #14 Protein Synthesis Introduction Proteins are vital for the survival of an organism. Proteins make enzymes and hormones which control reactions that must take place in the cell to survive.Proteins are made of basic units called amino acids. There are a total of 20 amino acids. Different proteins have different number and/or combination of amino acids. The kind of amino acid that is used when producing the protein depends on the 3-base code (codon) read from the RNA molecule...