An amino acid A, isolated from the acid-catalyzed hydrolysis of a peptide antibiotic, gave a positive ninhydrin test and had a specific optical rotation (HCl solution) of 37.5 mL/(g
An amino acid A, isolated from the acid-catalyzed hydrolysis of a peptide antibiotic, gave a positive...
Sanger's reagent is used A) to determine the amino acid sequence of a peptide. B) to determine the C-terminal amino acid of a peptide. C) to determine the isoelectric point of a peptide. D) to determine the number of amino acids in a peptide. E) to determine the N-terminal amino acid of a peptide. Ninhydrin is used A) to determine the N-terminal amino acid of a peptide. B) to sequence amino acids in a peptide. C) to detect amino acids...
How do amino acid residues Asp102, His 57, and Ser 195 participate in peptide bond hydrolysis as catalyzed by chymotrypsin?
Proteins are composed of amino acid units bound by peptide bonds. By the addition of the enzyme Bacterial Protease these bonds are broken and the individual amino acids are freed. A simple test for free amino acids is the use of the reagent Ninhydrin which turns purple in the presence of amino acids but remains yellowish in the presence of protein. I. Label one 250 ml beaker A and one 250 ml beaker B. To each beaker add l 00...
3. Amino acid analysis of a peptide seven residues long gave: Asp, Leu, Lys, Met, Phe, Tyr The following facts were observed: a. Trypsin treatment had no apparent effect b. Reaction with phenylisothiocyanate reagent yielded PTH-Phe c. Treatment with chymotrypsin yielded several products, including a dipeptide and a tetrapeptide. The amino acid composition of the tetrapeptide was Leu, Lys and Met. d. Cyanogen bromide treatment yielded a dipeptide, a tetrapeptide, and free lysine. What is the...
A peptide from a novel bacterial protein was isolated and sequenced. The amino acid sequence is NH2-Leu-Met-Pro-Tyr-Ser-Ala-Ala-Pro-Cys-Leu-Trp-Glu-Ala-Gly-Asp-Arg-COOH. To verify and clone the gene encoding this protein from this uncharacterized bacterium, a student has to purify the bacterial genomic DNA and use it as the template to isolate the DNA fragment that encodes this peptide using PCR. The student plans to design a pair of oligonucleotides as the forward and reverse primers to PCR the DNA fragment that encodes this peptide....
lor tests v2 - Word Search View Help B: Color Tests Positive or Negative? Observations Biuret Test (for oligopeptides and larger peptides) 1% Egg albumin solution 1% Glycine solution Page 2 of 7 Student: LAB DAY: D i lot Oligopeptide Help a protein is completely digested (hydrolyzed) component amino acids, what would be the It of a Biuret test? atom of the carboxyl group. When protein hydrolyzed the peptide bonds wil break and form present amino acids. Because the peptide...
Please help with these three questions
B. a. Cholesterol isolated from natural resources is enantiopure. The observed rotation of a 0.3 g or sample of cholesterol in 15 mL of chloroform solution contained in a 10 cm polarimeter tube is -0.78 °. Calculate the specific rotation of cholesterol. b. A sample of synthetic cholesterol consisting entirely of (+) cholesterol was mixed with some natural (-)-cholesterol. The specific rotation of the mixture was -13. What fraction of the mixture was (+)-cholesterol?...
A chain GIVEQCCASVCSLYQLENYCN B chain FVNQHLCGSHLVEALYLVCGERGFFYTPKA Shown above is the amino acid sequence of the hormone insulin. This structure was determined by Frederick Sanger and his coworkers. Most of this work is described in a series of articles published in the Biochemical Journal from 1945 to 1955. When Sanger and colleagues began their work in 1945, it was known that insulin was a small protein consisting of two or four polypeptide chains linked by disulfide bonds. Sanger and his coworkers...
ootical for pure substance is +40
1. As the new chemist working at "Drugs Us", you are given the task of resolving racemic phenylethyl- amine into its individual enantiomers using (S)-malic acid as resolving agent. After you carried out the resolution, you labeled the products you isolated "Sample A" and "Sample B. You subjected both samples to polarimetry ( = 589 nm (sodium D-line), 1-dm cell) and obtained the following results. Sample A: 1.00 g dissolved in 10.0 mL methanol...
Experiment 12: Synthesis of Benzoic Acid pre-lab (4 pts) 1 (2 pts) Refer to the introduction on the general process of hydrolysis of nitriles to carboxylic acids. Starting with benzonitrile (shown below), show how it is converted to benzoic acid under basic conditions. N 2) (2 pts) The reaction for the synthesis of benzoic acid via benzonitrile hydrolysis is shown below: 1) NaOH, HO YOH + NaCl 2) HCI, H,0 Benzonitrile Density = 1.0 g/mL MM = 103.04 g/mol Benzoic...