Can you draw the structure of the peptide sequence, “AWRSME”? What is its net charge at...
Homework Answers
the structure of the given peptide has bee prepared from the given symbols and based on the number of cooh and nh2 groups charge in different conditions has been mentioned;
Add Answer to:
Can
you draw the structure of the peptide sequence, “AWRSME”? What is
its net charge at...
can you draw the structure with stereochemistry for the following peptide sequence: “YES” please draw with...
can you draw the structure with stereochemistry for the following peptide sequence: “YES” please draw with stereochemistry and at a pH of 7.4
What is the net charge of the molecule with peptide sequence “AWRSME” at a pH of 7.4?
What is the net charge of the molecule with peptide sequence “AWRSME” at a pH of 7.4?
Imagine that you have just isolated a peptide hormone with the following primary sequence: MLSCRLQEALAALSKIVLADLGCVTGAPSDPR (Assume...
Imagine that you have just isolated a peptide hormone with the following primary sequence: MLSCRLQEALAALSKIVLADLGCVTGAPSDPR (Assume the protein is in solution at physiological pH, and remember to include the amino acids at each end of the chain. A charge may come from the R-group, the N-terminus, and/or the C-terminus. If a residue occurs more than once, include each one in your answer.) List the residues (individual amino acids) that contribute a positive charge: List the residues that contribute a...
Calculate the net charge on the following peptide that contains an intramolecular disufide bond at pH...
Calculate the net charge on the following peptide that contains an intramolecular disufide bond at pH 12. Assume that the peptide and disulfide bonds are stable at this pH. This question does not require you to draw the structure of this peptide, only to calculate the appropriate charge. You must identify where each charge comes from; you can't just give a final net charge number. Show all your work to obtain any-credit. (8 pts) QUESOn Calculate the net charge on...
A peptide has the sequence Glu-His-Trp-Ser-Gly-Leu-Arg-Pro-Gly a)name the peptide b)what is the net charge of the...
A peptide has the sequence Glu-His-Trp-Ser-Gly-Leu-Arg-Pro-Gly a)name the peptide b)what is the net charge of the molecule at Ph 3,8,12 c) Estimate pl
6. A peptide has the sequence Cys-His-Phe-Glu-Ala-Arg a. Write the single letter sequence of the peptide...
6. A peptide has the sequence Cys-His-Phe-Glu-Ala-Arg a. Write the single letter sequence of the peptide b. Calculate the percentage and indicate the charge of the predominant peptide species at pH 6.5. Use the following pKa values: pKa Cys = 8.3, pKa N-terminus = 10.8, pKa His =6.0, pKa Glu = 4.3, pKa Arg = 12.5, pKa C-terminus =2.0 c. What is the charge of the peptide at pH 4.3? d. Draw the chemical structure of the predominant peptide species...
Draw the extended structure of the peptide LFIKQMTS, label the residue at the N-terminus and C-terminus....
Draw the extended structure of the peptide LFIKQMTS, label the residue at the N-terminus and C-terminus. Show the full name and three letter abbreviations of each amino acid. Estimate the approximate pI of the peptide. What is the net charge of the peptide at pH 2.0 and pH 7.5? I just need help with calculating the pI because I am not sure that I am doing it correctly. Thank you!
Click the "draw structure" button to launch the drawing utility. Draw the following peptide at physiological...
Click the "draw structure" button to launch the drawing utility.
Draw the following peptide at physiological pH. Lys-trp-pro
edit structure ...
Н н Н Н H3N C N- C -N- C co O C I IZ
8:20 PM Draw the structure of the peptide abbreviated PARTY as it would exist at physiological...
8:20 PM Draw the structure of the peptide abbreviated PARTY as it would exist at physiological pH Calculate the isoelectric point for this peptide. (Use pK values from Table 4-1.) 4.
An amino acid does not contain an ionizable side chain. What will be its net charge...
An amino acid does not contain an ionizable side chain. What will be its net charge at physiological pH, if the amino acid is free (not in a peptide)? oo 0+1 0-1 cannot be determined
Calculate the net charge on the following peptide that contains an intramolecular disufide bond at pH 12. Assume that the peptide and disulfide bonds are stable at this pH. This question does not require you to draw the structure of this peptide, only to calculate the appropriate charge. You must identify where each charge comes from; you can't just give a final net charge number. Show all your work to obtain any-credit. (8 pts) QUESOn Calculate the net charge on...
6. A peptide has the sequence Cys-His-Phe-Glu-Ala-Arg a. Write the single letter sequence of the peptide b. Calculate the percentage and indicate the charge of the predominant peptide species at pH 6.5. Use the following pKa values: pKa Cys = 8.3, pKa N-terminus = 10.8, pKa His =6.0, pKa Glu = 4.3, pKa Arg = 12.5, pKa C-terminus =2.0 c. What is the charge of the peptide at pH 4.3? d. Draw the chemical structure of the predominant peptide species...
Click the "draw structure" button to launch the drawing utility.
Draw the following peptide at physiological pH. Lys-trp-pro
edit structure ...
Н н Н Н H3N C N- C -N- C co O C I IZ
8:20 PM Draw the structure of the peptide abbreviated PARTY as it would exist at physiological pH Calculate the isoelectric point for this peptide. (Use pK values from Table 4-1.) 4.
An amino acid does not contain an ionizable side chain. What will be its net charge at physiological pH, if the amino acid is free (not in a peptide)? oo 0+1 0-1 cannot be determined
Most questions answered within 3 hours.
-
Where is the error in this code sequence?
String s1 = "Hello";
String s2 = "ello";...
asked 11 months ago -
Financial data for Joel de Paris, Inc., for last year
follow:
Joel de Paris, Inc.
Balance...
asked 11 months ago -
Consider this reaction:
Al2(SO4)3 (aq)+ BaCl3
(aq) Al2Cl6 (aq)- +
3BaSO4(s) . What is the...
asked 11 months ago -
Suppose that Savneet is considering increasing her
recent random sample from 20 car rentals to 40...
asked 11 months ago -
Trucks arrive at an unloading terminal at an average rate of 120
per hour.
Trucks arrive...
asked 11 months ago -
Why are methanol and ethanol completely soluble in water while
octanol is not very little soluble....
asked 11 months ago -
A facilities manager at a university reads in a research report
that the mean amount of...
asked 11 months ago -
When the CuSO4 is rehydrated by adding water to the anhydrous
compound, is this an endothermic...
asked 11 months ago -
A ray of sunlight is passing from diamond into crown glass; the
angle of incidence is...
asked 11 months ago -
A block of mass 0.249 kg is placed on top of a light, vertical
spring of...
asked 11 months ago -
how do the kidneys compensate in the presences of acidosis
a) trigger hyperventilate
b) reserve acid...
asked 11 months ago -
Question 501 pts
The rental rate of capital to the firm increases. Which of the
following...
asked 11 months ago