Calculate the net charge on the following peptide that contains an intramolecular disufide bond at pH...

Question

Question

Calculate the net charge on the following peptide that contains an intramolecular disufide bond at pH 12. Assume that the pep

QUESOn Calculate the net charge on the following peptide that contains an intramolecular disulfide bond at pH 12. Assume that

science biology

Answer 1

Answer #1

The net charge of peptide at pH 12:-

COO-Asn-Glu-Cys-His-Ser-Cys-Lys-NH3+

=pKa of COO- 3. pKa NH3+ 10

IF pKa is greater than pH, protonation occurs and vice versa.

Net charge=. - 1+0-1+0+0-1+0+0+0. = - 3 net charge

Answer 2

Similar Homework Help Questions

You are given a peptide Ala-Cys-Leu that is oxidized to form a disulfide bond with another...

You are given a peptide Ala-Cys-Leu that is oxidized to form a disulfide bond with another Ala-Cys-Leu. What is its net charge at pH 12? What is its net charge if the disulfide bonds are reduced?
Hi. Please show work and I will gladly rate! 22. Calculate the net charge on the...

Hi. Please show work and I will gladly rate! 22. Calculate the net charge on the following peptide at pH 8. Arg-Glu-Gln-Asn-Asp-His-Lys-Arg-Glu-Asp
Indicate which of the amino acid residues in the following peptide sequence contains a group that...

Indicate which of the amino acid residues in the following peptide sequence contains a group that has a negative charge for its most likely charge state at pH 10. Phe-Val-Pro-His-Trp-Asn-Cys-Thr-Asp Please explain in detail how you got the answer. thank you!

Consider the following peptide: Lys-Tyr-Glu-His- Glu-Ala- Arg-His-Lys What is the net charge of this peptide at...

Consider the following peptide: Lys-Tyr-Glu-His- Glu-Ala- Arg-His-Lys What is the net charge of this peptide at pH = 1 (you must show work for full credit!)? What is the net charge of this peptide at pH = 14 (you must show work for full credit!)?
-2. Which of the following tripeptides would carry a net charge of-1 at pH 7? Markallthatapply....

-2. Which of the following tripeptides would carry a net charge of-1 at pH 7? Markallthatapply. (3 pts.) A. Asp-Ala-Arg C. Lys-Gly-Asn D. Glu-Lys-Asp E. Leu-Asp-Glu F. Arg-lleu-Cys B. Met-Pro-Glu The Kd for a dimeric protein complex is 2.2 μM. (3 pts.) Mark all that are true about this dimeric protein complex. A. 3. At equilibrium, the concentration of the individual subunits is very, very low. B. If this is a homodimer, it can be called an αβ dimer. C....
What is the approximate net charge of the following pentapeptide at pH 10? Arg-Gln-Cys-His-Ala What is...

What is the approximate net charge of the following pentapeptide at pH 10? Arg-Gln-Cys-His-Ala What is the Isoelectric point (pI) of the peptide given above? Use the pKa values given here when needed: Side group/ amino acid pKa Asp 3.9 Glu 4.1 HIs 6.0 Cys 8.4 Tyr 10.5 Lys 10.5 Arg 12.5 C-term 3.5 N-term 9.0

Calculate the net charge of a peptide sequence W-S-N-G-C-H (all connected : Tryptophan-Serine-Asparagine-Glycine-Cysteine-Histidine) pKa values at...

Calculate the net charge of a peptide sequence W-S-N-G-C-H (all connected : Tryptophan-Serine-Asparagine-Glycine-Cysteine-Histidine) pKa values at (a) pH 2.0, (b) 6.0 (c) 7.0 and (d) 11.5. Assuming the ionisable groups have pKa values of His 6.0, Asp 3.6, Tyr 10.0, Cys 8.3, Arg 12.5, Lys, 10.5, Glu 4.3 C-term -COOH 2.0, N-term -NH3 + 9.5.
19. Calculate the net charge on the following nonapeptide at the physiological pH 7.4, and predict...

19. Calculate the net charge on the following nonapeptide at the physiological pH 7.4, and predict the peptide's mobility in an electric field. Explain your answer. (4 pts) Gln-Tyr-Ala-Phe-Gly-Cys-Ser-His-Asp.
Imagine that you have just isolated a peptide hormone with the following primary sequence: MLSCRLQEALAALSKIVLADLGCVTGAPSDPR (Assume...

Imagine that you have just isolated a peptide hormone with the following primary sequence: MLSCRLQEALAALSKIVLADLGCVTGAPSDPR (Assume the protein is in solution at physiological pH, and remember to include the amino acids at each end of the chain. A charge may come from the R-group, the N-terminus, and/or the C-terminus. If a residue occurs more than once, include each one in your answer.) List the residues (individual amino acids) that contribute a positive charge: List the residues that contribute a...

Calculate the net charge of arginine (pK1=2.17, pK2=9.04, pK3=12.48) at pH 6.0. In order to calculate...

Calculate the net charge of arginine (pK1=2.17, pK2=9.04, pK3=12.48) at pH 6.0. In order to calculate the net charge you must first calculate the percent “charged” for each ionizable functional group in the chemical structure of arginine. Use four significant digits in your calculation of the net charge.