Question

Please help. Thanks.

Following the sequencing of genomic DNAs from two individuals, the following chromatograms were observed. Use the chromatogra

0 0
Add a comment Improve this question Transcribed image text
Answer #1

a) Heterozygous genotype in a chromatogram can be identified with the presence of a single peak position having 2 peaks of different colors instead of just one.

So sample with point mutation shows heterozygous genotype

b) Amino acid sequence for wild type

Coding strand = 5’ ACT TTT GAC 3’

amino acid sequence= Thr Phe Asp

For point mutation

Coding strand= 5’ ACT TTN GAC

amino acid sequence= Thr Phe/ Leu Asp

c) If T replace with C than silent mutation will take place

If T replace with A or G than missense mutation will be there as phenylalanine (aromatic) will change to leucine (non aromatic)

Add a comment
Know the answer?
Add Answer to:
Please help. Thanks. Following the sequencing of genomic DNAs from two individuals, the following chromatograms were...
Your Answer:

Post as a guest

Your Name:

What's your source?

Earn Coins

Coins can be redeemed for fabulous gifts.

Not the answer you're looking for? Ask your own homework help question. Our experts will answer your question WITHIN MINUTES for Free.
Similar Homework Help Questions
  • Please note that Questions 15 to 17 are connected questions. Question 15: The following shows a...

    Please note that Questions 15 to 17 are connected questions. Question 15: The following shows a partial DNA sequence from the wild-type (normal) allele for the human leukemia-linked apoptotic gene.   5' ATGCGATTAATCGGTAAA 3' (non-template strand) 3' TACGCTAATTAGCCATTT 5' (template strand) Please answer the following questions: (a) If the bottom strand serves as the DNA template for transcription, what is the resulting mRNA sequence? The mRNA sequence is  5'  3'. (2 marks) 5' AUG CGA UUA AUC GGU AAA 3' ? Please enter...

  • You have a small gene that encodes the following amino acid: N-MET-ASP-SER-VAL-ALA-ARG-PHE-MET-TRP-C. There is a single...

    You have a small gene that encodes the following amino acid: N-MET-ASP-SER-VAL-ALA-ARG-PHE-MET-TRP-C. There is a single mutation in the DNA that causes a change in the amino acid sequence to: N-MET-VAL-GLN-TRP-PRO-ASP-LEU-CYS-GLY-C. a) What kind of mutation is this? Explain. (2 points) b) Indicate the DNA sequence (coding strand) of the gene. Show the original DNA sequence then the mutated sequence. Wild type DNA: Mutant DNA: You have another mutation (a different mutation from the one described in parts a and...

  • Please help me with biology 1. Online exercise: Find reports that document the relationship between the...

    Please help me with biology 1. Online exercise: Find reports that document the relationship between the age of the mother and the risk for having a baby with Down Syndrome (Trisomy 21). For your interest only 2. Suppose that during transcription of a gene, RNA polymerase mistakenly inserts an incorrect base opposite the template DNA. This error results in an mRNA with an altered nucleotide sequence. Is this a mutation? For questions 3-10, consider the following mRNA, which is the...

  • Any help would be appreciated! S y of a protease activity of Science you decided to...

    Any help would be appreciated! S y of a protease activity of Science you decided to develop a series of peptide sequence to probe sequence versus activity profiles. boa experimenting the lo n g e sequence versus activity profiles You deseo DNA plecamid sequence entire plasmid not shown-just the ce desired Answer the e plasmid not show-just the site of interest and DNA questions using these sequences (24 pts) Plasmid Sequence (selected insert portion)" TCGAGCCGATATCCTGCAGCGATGAAGCTTGOTAGOGTCGACTAACACTGCAGOTCOACCO AGCGCTATAGGACOTCGCTACTTCGAACCATCGCAGCTGATTGTGACGTCCAGAR rege Althe t he...

  • Question 20 (1 point) Figure out the mutation. You will need the codon table to answer...

    Question 20 (1 point) Figure out the mutation. You will need the codon table to answer this question. Wild type genomic sequence of a portion of a gene and the wild type sequence of portion of the protein gene product. The protein sequence only matches partially. TAT AAA GGG CGA CCA CCT GGT AAT GGG ACT TTG AGG Tyr Lys Gly Arg Pro Pro Ala Pro Arg Gin Tyr Trp Note: The five amino acids at the amino end of...

  • Question 16: The following shows the same segment of DNA that was shown above in Question...

    Question 16: The following shows the same segment of DNA that was shown above in Question 15, however, this DNA sequence is for the mutant allele for the collagen type 1 gene. This mutated allele is responsible for a genetic skeletal disorder called osteogenesis imperfecta. 5' ATGCTATGGGCATGATCCCAGCCT 3' 3' TACGATACCCGTACTAGGGTCGGA 5' Answer the following questions: (a) If the bottom strand serves as the DNA template for transcription, what is the resulting mRNA sequence for this mutant allele? The mutated mRNA...

  • I've provided info, just need help to answer the question with this info. Thanks. "ybase.01. eports/rDaru...

    I've provided info, just need help to answer the question with this info. Thanks. "ybase.01. eports/rDaru Nature of the Allele Allele class amorphic allele - genetic evidence (Georgiev and Corces, 1995, Geyer et al., 1990) loss of function allele (Drapeau et al., 2006) spontaneous (Morris et al., 1999) Mutagen Mutations Mapped to the Genome Type Location X:356,680.356,680 [+] References (Geyer et al., 1990) point mutation Additional Notes Comment: Ato C tranversion in the ATG translation initiatio n codon. The reference...

  • Some amino acids are post-translationally removed from the C-terminal end of the beta-lactamase enzyme from B....

    Some amino acids are post-translationally removed from the C-terminal end of the beta-lactamase enzyme from B. imaginarium (i.e. - after it is translated and released from the ribosome, a protease chews off a some amino acids).  The wild-type enzyme, which has had the amino acids removed from the C’-terminus, is 246 amino acids in length and the C-terminal amino acids are shown below aligned with the C-terminal amino acids of a frameshift mutant, which – due to a frameshift mutation -...

  • Questions 11-15: Gene structure/Splicing problem. "Protein X" consists of a total of 431 amino acids. Your...

    Questions 11-15: Gene structure/Splicing problem. "Protein X" consists of a total of 431 amino acids. Your colleague, techniques) the a biochemist, has purified the protein and determined (via complicated and messy chemical sequence of the first 37 amino acids in the protein, which she has reported to you as follows: HN- MSNITVDDELNLSREQQGFAEDDFIVIKEERETSLSP . nwhile, you have isolated a genomic clone of the gene that codes for protein X, and determined the DNA equence of the first 227 bases from the...

  • 70. RNA synthesis in bacteria requires which of the following? a. DNA polymerase III b. A...

    70. RNA synthesis in bacteria requires which of the following? a. DNA polymerase III b. A primer c. A DNA template d. DNA Gyrase e. Deoxyribonucleotide triphosphate 86. Two phenotypically normal people have 4 children. 3 are phenotypically normal like their parents, but one is an albino. What are the probable genotypes of the parents? a. Both parents are homozygous dominant b. Both parents are homozygous recessive c. One parent is homozygous dominant and the other is homozygous recessive d....

ADVERTISEMENT
Free Homework Help App
Download From Google Play
Scan Your Homework
to Get Instant Free Answers
Need Online Homework Help?
Ask a Question
Get Answers For Free
Most questions answered within 3 hours.
ADVERTISEMENT
ADVERTISEMENT