If a protein has 200 amino acids, and the gene that codes for it has 50 percent intron nucleotides, the number of nucleotides in the gene will be approximately:
Select one:
a. 200
b. 400
c. 600
d. 1200
e. 1000

If a protein has 200 amino acids, and the gene that codes for it has 50...
Questions 11-15: Gene structure/Splicing problem. "Protein X" consists of a total of 431 amino acids. Your colleague, techniques) the a biochemist, has purified the protein and determined (via complicated and messy chemical sequence of the first 37 amino acids in the protein, which she has reported to you as follows: HN- MSNITVDDELNLSREQQGFAEDDFIVIKEERETSLSP . nwhile, you have isolated a genomic clone of the gene that codes for protein X, and determined the DNA equence of the first 227 bases from the...
Question 2: Transcription, RNA Processing and Translation A particular gene codes for a mature mRNA transcript containing 1200 bases, which is translated into a protein containing 300 amino acids. A. How long is the coding sequence in this mRNA and how many nucleotides are in the UTRs? For the purposes of this question we are ignoring the G’ cap and the polyA tail. B. A mutant form of the gene created by one nucleotide being changed to another nucleotide also...
QUESTION 7 Consider the hypothetical gene show here. The gene coding sequence consists of 4 exons (shown in solid colors). The 5' UTR and 3' UTR are shown as striped boxes. 25 150 200 300 400 25 Based on the lengths of the exons, you should be able to calculate a rough estimate of the protein encoded by this gene, assuming that all 4 exons are translated and the protein does not undergo any significant processing (cleavage or chemical modifications)....
You have identified a novel activator protein. You assume that
like other activators, your protein has activation and DNA binding
domains. You carry out deletion analysis on the part of the ORF
that codes for the C-terminal end of your activator and assay both
DNA binding and transcription. You obtain the results indicated in
the figure below. Answer the following 3 parts (i,ii, &
iii) based on this information.
i. Which most accurately describes which part of the protein
contains...
A gene has 3 exons and 2 introns. While analyzing a mutant, you discover that 9 basepairs are inserted in the middle of intron 1 of this gene. What is the effect of this insertion on the protein? Select one: a. this insertion will have no effect on the protein b. The protein is likely non-functional because the insertion caused a frameshift c. The protein has 3 extra amino acids d. the transcription will be terminated e. the type of...
A gene has 3 exons and 2 introns. While analyzing a mutant, you discover that 9 basepairs are inserted in the middle of intron 1 of this gene. What is the effect of this insertion on the protein? Select one: a. the type of amino acid replacement will determine the effect of this insertion O b. The protein is likely non-functional because the insertion caused a frameshift c. The protein has 3 extra amino acids d. this insertion will have...
Below is a schematic of gene Hemoglobin beta subunit (HBS), which
encodes protein HBS. The promoter region is indicated by the dotted
box. Transcriptions begins immediately following the promoter. The
mature mRNA produced by this gene would be approximately how many
nucleotides long?
A) 100
B) 200
C) 3000
D) 5000
E) 7000
1. Below is a schematic of gene Hemoglobin beta subunit (HBS), which encodes protein HBS. The promoter region is indicated by the dotted box. Transcription begins immediately...
why is E the answer
Below is the genomic DNA of gene X, a 3 exon gene that encodes a 131 amino acid single pass transmembrane protein. Shown are the transcriptional start site, splice donor, acceptor and branch sites and translational start and stop codons. Transcriptional start EXON 1 INTRON 1 EXON 2 INTRON 2 EXON 3 Spfice Donor Splice Acceptor Polyadenylation signal Branch point 17. Treatment with ethidium bromide, an intercalating agent, caused DNA polymerase to add an extra...
Protein Structure A protein contains a string of amino acids (usually more than 50) that has a biological function. 15ecause proteins are so large, their structure has several levels, all of which are important for the proper functioning of the protein. Ultimately, the sequence of amino acids (ordering of polar and nonpolar amino acids) dictates the 3-dimensional shape of a protein and this dictates its primary function. Level 1: Primary (1") The amino acid sequence of a polypeptide Protein Backbone...
Please answer all.... Thank you!
81)If a polypeptide chain contains 600 amino acids, then the
gene coding for this polypeptide must contain _____.
600 nucleotides
1200 nucleotides
1800 nucleotides
1800 codons
1800 anticodons
More than one of the above are correct.
82) When we altered gene triplet in the DNA produces a chain-terminating codon in the mRNA, the (1pts) result is called a reverse mutation nonsense mutation missense mutation spontaneous mutation frameshift mutation 83) A single base substitution changes the...