Question

1. Given the sequence labeled "original" below, identify the point mutations in the mutant sequence below,...

1. Given the sequence labeled "original" below, identify the point mutations in the mutant sequence below, and determine which are silent, missense, or nonsense. Assume both sequences are part of a coding strand with an upsteam code. (6 points)

5'- AGTCCATGCCCC -3' -----------original sequence
5'- AGCCAATGACGC -3'------------mutant sequence

0 0
Add a comment Improve this question Transcribed image text
Answer #1

5'- AGTCCATGCCCC -3' -----------original sequence
5'- AGCCAATGACGC -3'------------mutant sequence

there are 4 point mutations

1) AGT is changed to AGC this is silent mutation because both AGT and AGC codes for same amino acid Serine

2) CCA changed to CAA this is missense mutation because CCA codes for proline and CAA codes for glutamine

3) TGC changed to TGA this is nonsense mutation TGC is changed to TGA, TGA is a stop codon

4) CCC changed to CGC this is missense mutation because CCC codes for proline and CGC coded for arginine

Add a comment
Know the answer?
Add Answer to:
1. Given the sequence labeled "original" below, identify the point mutations in the mutant sequence below,...
Your Answer:

Post as a guest

Your Name:

What's your source?

Earn Coins

Coins can be redeemed for fabulous gifts.

Not the answer you're looking for? Ask your own homework help question. Our experts will answer your question WITHIN MINUTES for Free.
Similar Homework Help Questions
  • 1. You have used a mutagen to induce mutations in a DNA sequence.  If the original DNA...

    1. You have used a mutagen to induce mutations in a DNA sequence.  If the original DNA strand is 5'-ATGGGACTAGATACC-3', then which of the following represents a nonsense mutation? (1pt) 5'-ATGGGTCTAGATACC-3' 5'-ATGCGACTAGATACC-3' 5'-ATGTGACTAGATACC-3' 5'-ATGGGACTAAGATACC-3' 2. A mutation that changes a codon sequence, and subsequently changes the amino acid that should have been placed at that point in the polypeptide chain, is called a… (1pt) silent mutation frameshift mutation missense mutation nonsense mutation 3. Excision repair corrects DNA by (1pt) correcting A=T...

  • Bis 101 help Question 6 1 pts 6. (1pts) The following DNA sequence 5- AGTCGCCCATGCCG-3'undergoes a...

    Bis 101 help Question 6 1 pts 6. (1pts) The following DNA sequence 5- AGTCGCCCATGCCG-3'undergoes a mutation in which an A nucleotide is inserted at the 5' end of the molecule. How would you classify this mutation? Frameshift mutation Silent mutation Nonsense Mutation Missense mutation D Question 7 2 pts 7.(2 pts) Below is a DNA sequence encoding an mRNA strand. What are the first four amino acids that this sequence codes for? (Not that the coding strand has been...

  • Question 38 16 pts Question Code CDC The following sequence represents the DNA template strand of...

    Question 38 16 pts Question Code CDC The following sequence represents the DNA template strand of a gene, 3'-TAC CGT GTC TCC TCA GGC ATC-5' nucleotide number 1 21 a. What is the mRNA transcribed from this sequence? b. What is the amino acid sequence translated from the mRNA? c. If there is a transition at nucleotide #10, what is the amino acid sequence? R REROS d. What type of mutation is this (choose from frameshift, missense, nonsense, silent)? e....

  • 4. Now consider the sequence that results for a different mutant protein. Using the DNA coding...

    4. Now consider the sequence that results for a different mutant protein. Using the DNA coding and sequence provided, predict the sequences of the DNA template strand, mRNA, and polypeptide for the mutant gene. DNA coding strand for mutant gene 3: 5'ACTGCCCATGGTGGTACCT GAC TCC TGAGGAG 3' On the line above, write the sequence for the template DNA strand. On the line below, write the sequence for the mRNA for mutant protein: On the line below, write the sequence for the...

  • Below, you can find a partial sequence of last 30 amino acids of a certain protein...

    Below, you can find a partial sequence of last 30 amino acids of a certain protein (amino acids, single-letter code). There are also mutated sequences of the same protein. Explain which mutations could have happened. (pay attention to the sequence length and the sequence itself) (25) Original                 GVLSEGEWQLVLHVWAKVEADVAGHGQDIL Mutant 1             GVLSEGEWQLVLHV Mutant 2             GVLSEGEWQLVHVWAKVEADVAGHGQDIL Mutant 3             GVLQHDAWQLVLHVWAKVEADVAGHGQDIL Mutant 4             GVLSEGEWQLVLHVWAKVEAWLWVMGHEVMLQ Mutant 5             GVLSEGEWQLVLHVWAKVEADVAGHGQDILWALWQAEVGQLIGH

  • Given the template DNA sequence below: 3'-CCACCTTCTATACTTCGCGGAATGCCGGTCCATGTAGGTTCACATTAGCGT-5' 6. An error occurred in DNA replication, A was...

    Given the template DNA sequence below: 3'-CCACCTTCTATACTTCGCGGAATGCCGGTCCATGTAGGTTCACATTAGCGT-5' 6. An error occurred in DNA replication, A was incorporated in the place of T (indicated in yellow color in the aforementioned sequence) from the gene. Write the corresponding DNA template strand and transcribe the mutated mRNA strand, then determine the amino acid sequence of the mutant protein. If a stop codon is not present, create one by adding sequences to the gene and mRNA.

  • Shown below are the amino acid sequences of the wild-type and three mutant forms of a...

    Shown below are the amino acid sequences of the wild-type and three mutant forms of a short protein. Each mutation results from a single nucleotide change (transition/transversion / insertion / deletion). Use this information to answer the following questions. Hint: First, reconstruct as much as you can of the wild-type RNA sequence and then reference that sequence when analyzing the mutations. Wild type: met - gin-ala - ser-val - arg - phe Mutant 1: met - gln - pro-ser -...

  • Shown below are the amino acid sequences of the wild-type and three mutant forms of a...

    Shown below are the amino acid sequences of the wild-type and three mutant forms of a short protein. Each mutation results from a single nucleotide change (transition / transversion / insertion / deletion). Use this information to answer the following questions. Hint: First, reconstruct as much as you can of the wild-type RNA sequence and then reference that sequence when analyzing the mutations. Wild type: met – gln – ala – ser – val – arg – phe Mutant 1:...

  • A single mutation has occurred in the following DNA sequence. 5' ATG TTG GCC CAT 3'...

    A single mutation has occurred in the following DNA sequence. 5' ATG TTG GCC CAT 3' wild-type (normal) sequence 5' ATG TTG CCC CAT 3' mutant sequence    (a) Identify and classify the mutation according to its molecular structure (i.e., insertion, deletion base substitution (transversion), or base substitution (transition)). Briefly explain why you selected this classification. (1.75 marks)    (b) Identify and classify the mutation according to its functional effects (i.e., frameshift, missense, nonsense, or silent). Briefly explain why you...

  • Genetic code: 1. How many silent mutations can be made starting from the codon TGG? (2...

    Genetic code: 1. How many silent mutations can be made starting from the codon TGG? (2 points) A. O B. 1 C. 2 D. 3 Answer: 2. How many single base changes result in nonsense mutations for the codon TCA? (2 points) A. O B. 1 C. 2 D. 3 E. 4 Answer: 3. How many single base change missense mutations are possible for codon ATG resulting in how many different amino acids? (2 points) A. 3,3 B. 5, 3...

ADVERTISEMENT
Free Homework Help App
Download From Google Play
Scan Your Homework
to Get Instant Free Answers
Need Online Homework Help?
Ask a Question
Get Answers For Free
Most questions answered within 3 hours.
ADVERTISEMENT
ADVERTISEMENT