Putative transformants are the segments of gene that can perform the function of that particular segment that has already been assigned the characterised function and hence can be inferred to perform that function. The research for the putative transformants is still continued to know more details and so that we can use it wisely to do more difficult function.
The examples of putative transformants are
Thus it's very imporimportant to identify putative Gene and it can be very well done by complementation and knock out experiments.
It also helps in genomics evolution. Software tools are also used for identifying the putative transformants.
Hope it helped you , please like this answer and all the best for studies.
Define putative transformants and its relationship with DNA
Give three approaches that could be used to confirm that a putative peptides/proteins is exist.
What is the size and pI of this putative protein >XP_012347710.1 PREDICTED: E3 ubiquitin-protein ligase MARCH8 [Apis florea] MPVHQINVNPPDRQPPLSLGSSNNNSPAGGEGLPEWTSKESTYPTVVTIIPDHYHSSVSTLSSSNDICRI CHCEGEEGAPLLAPCYCSGSLRYVHQACLQQWIKASDTRACELCKFTFIMHAKTKPFCEWEKLEMSALEV RKLWCAVAFHAVAALCVAWSLYVLVERSVEEARRGYVDWSFWTKLIVVVIGSTGGLVFMYIQCKVYITLC RKWRAFNRVIFIQNAPEKVVLPPSPTDSLREVTLPLKDPTASMPELNHSLLPCNIDPPCASQMVKPDSAA PPQRHDAQLKLYVFDKLSSSEDNL
1. You are planning to study a gene ydeH from E.coli that encode for putative diguanylate cyclase activity (synthesis of a second messanger c-di-GMP). The in vitro enzymatic assay requires incubation of protein with GTP. List the steps involve in purification of protein. (hint : you need to clone the gene, express and purify the protein for in vitro assays.) 1a. Find the sequence of gene: Using NCBI or other database 2b. Design a strategy to clone and express the...
QUESTION 16 The putative distinction between killing and letting die breaks down into two related distinctions: there is a conceptual distinction and a moral distinction. The equivalence thesis is the claim that: O a If an act of killing and an act of letting die are carried out with equivalent intentions and equivalent consequences, then they are conceptually equivalent, even if there is a coherent moral distinction between killing and letting die. b. If an act of killing and an...
The starting concentration of the plasmid DNA is 100 ngul and you added 2μ1 to your cells. The cells were diluted to one ml prior to plating. First, determine how many transformants you would have if you plated the entire 1 ml of cell:s. Remember, you only plated half or your transformation reaction on plates 1 and 2. Add the number of transformants on plates 1 and 2, and then multiply by 2 for the total number transformants. Record that...
Protection Motivation theory Concept (define) Constructs: Threat Appraisal (define) Coping Appraisal (define)
Explain the evaluation of the following Scheme code: (define x 10) (define y 11) (define proc2 (lambda () (cons x (cons y '())))) (define proc1 (lambda (x y) (proc2))) (define main (lambda () (cond ((zero? (read)) (proc1 5 20)) (else (proc2))))) (main)
13. Joint Commission (ICAHO)-define and list role 14. OSHA-define and list role 15. CLIA define and list role 16. NFPA Labeling System.define and list health hazard for each color 17. FDA define and list role 18. HAZCOM-define and state key point 19. MSDS define and give an example of a product requiring a MSDA 20. HICPAC-define and list role 21. Fomite-define and give an example 22. List the procedure to follow after an exposure incident: 23. Blood-borne pathogen- define and...
1.define client-side marketing 2. define supply side research 3.define sugging and fugging