Question

Sequence 1: 5 TAGGTGAAAGAGTAGCCTAGAATCAGTTA 3 Sequence 2: 5 TAACTGATTTCTTTCACCTA 3 a. Which sequence is the genomic fragm

0 0
Add a comment Improve this question Transcribed image text
Answer #1

Ans a)sequence 1is the genomic fragment and sequence 2 is the cDNA.

Ans b)3'-UUCCUCUUUCUCUUCGGUUCUUUGUCUUU-5'

The vertical line between the bases that are exon and introns are:-

Intron Exon 3 30 Ans cs The Sequence features needed for Splicim cing 5Sp lice Sile Branch Stte 3splice site

Add a comment
Know the answer?
Add Answer to:
Sequence 1: 5' TAGGTGAAAGAGTAGCCTAGAATCAGTTA 3' Sequence 2: 5' TAACTGATTTCTTTCACCTA 3' a. Which sequence is the genomic...
Your Answer:

Post as a guest

Your Name:

What's your source?

Earn Coins

Coins can be redeemed for fabulous gifts.

Not the answer you're looking for? Ask your own homework help question. Our experts will answer your question WITHIN MINUTES for Free.
Similar Homework Help Questions
  • Below is the genomic DNA of gene X, a 3 exon gene that encodes a 131 amino acid single pass trans...

    why is E the answer Below is the genomic DNA of gene X, a 3 exon gene that encodes a 131 amino acid single pass transmembrane protein. Shown are the transcriptional start site, splice donor, acceptor and branch sites and translational start and stop codons. Transcriptional start EXON 1 INTRON 1 EXON 2 INTRON 2 EXON 3 Spfice Donor Splice Acceptor Polyadenylation signal Branch point 17. Treatment with ethidium bromide, an intercalating agent, caused DNA polymerase to add an extra...

  • Questions 11-15: Gene structure/Splicing problem. "Protein X" consists of a total of 431 amino acids. Your...

    Questions 11-15: Gene structure/Splicing problem. "Protein X" consists of a total of 431 amino acids. Your colleague, techniques) the a biochemist, has purified the protein and determined (via complicated and messy chemical sequence of the first 37 amino acids in the protein, which she has reported to you as follows: HN- MSNITVDDELNLSREQQGFAEDDFIVIKEERETSLSP . nwhile, you have isolated a genomic clone of the gene that codes for protein X, and determined the DNA equence of the first 227 bases from the...

  • Genes in eukaryotes are often organized into exons and intrans, which require splicing to produce an...

    Genes in eukaryotes are often organized into exons and intrans, which require splicing to produce an mRNA that can be translated. The gene organization is the order of the DNA segments that comprise the gene starting with the promoter, the first exon, the first intron, the second exon, and so on. The interspersed intrans can make gene identification difficult in eukaryotesparticularly in higher eukaryotes with many introns and alternative spliced mRNAs. Prediction of many genes and their organization has been...

  • Hint 1. How is a complete initiation complex formed? Drag the labels to their correct locations...

    Hint 1. How is a complete initiation complex formed? Drag the labels to their correct locations in the diagram to describe the roles of the various transcription factors in the formation of a complete initiation complex Reset Help part of initial committed complex TFIIA IIB added during formation of minimal initiation complex sa cosci.ccccccca RNA polymerase II added during formation of complete initiation complex Submit Request Answer Hint 2. How is pre-mRNA processed into mature mRNA? Select the two statements...

  • A sequence of a eukaryotic gene (coding strand) is shown below, RNA polymerase recognizes the sequence...

    A sequence of a eukaryotic gene (coding strand) is shown below, RNA polymerase recognizes the sequence ‘TATAAT’ and initiates transcription six nucleotides downstream of the sequence. The intron splice sites are CUU (5’ splice site) and AAG (3’ splice site), poly-A tails are added following the sequence AGUUGG. The poly-A tails are 20 nucleotides. b. If this is an oncogene that is elevated in cancer cells, design two siRNAs to knock down the mRNA, list the sequences of the siRNAs...

  • 6. Compare the following sequences and answer the question that follows: Genomic DNA (coding strand) 5'-...

    6. Compare the following sequences and answer the question that follows: Genomic DNA (coding strand) 5'- ATTGCATCCAGCGTATACTATCTCGGGCCCAATTAATGCCAGCGGCCAGACTATCACCCAA CTCGGTTACCTACTAGGTAAGTAATACCATACATACAAAATCACTGACTCTGTTGAATATT TATTACTCCCTCTTTTCTGCAGATTATCCCATATACTAGCATATATTTTACCCATAATTTG TGTGTGGGTATACAGTATAATCATATA - 3 Spliced mRNA 5'- AUUGCAUCCAGCGUAUACUAUCUCGGGCCCAAUUAAUGCCAGCGGCCAGACUAUCACCCAA CUCGGUUACCUACUAGAUUAUCCCAUAUACUAGCAUAUAUUUUACCCAUAAUUUGUGUGUG GGUAUACAGUAUAAUCAUAUA - 3'. Indicate where the intron is located. Where are the splice site sequences?

  • Hemoglobin is a protein that is found in red blood cells. It binds to oxygen in...

    Hemoglobin is a protein that is found in red blood cells. It binds to oxygen in the lungs and it carries it to tissues and cells throughout the body. Hemoglobin is made of four polypeptide chains, two called “alpha-globins” (a) and two “beta-globins" (B). The B-globin polypeptide is produced in the cells based on the sequence of the HBB gene. The structure of the HBB gene that codes for beta-globin is represented below. The primary transcript is 1606 nucleotides long....

  • 1. A sequence of a eukaryotic gene (coding strand) is shown below, RNA polymerase recognizes the...

    1. A sequence of a eukaryotic gene (coding strand) is shown below, RNA polymerase recognizes the sequence ‘TATAAT’ and initiates transcription six nucleotides downstream of the sequence. The in tron splice sites are CUU (5’ splice site) and AAG (3’ splice site), poly -A tails are added following the sequence AGUUGG. The poly- A tails are 20 nucleotides. a. Predict the sequence of mature mRNA and denote 5’ and 3’ ends. b. If this is an oncogene that is elevated...

  • 4. Which form of DNA is possible as well as the linear form? a. circular b....

    4. Which form of DNA is possible as well as the linear form? a. circular b. stem loop c. A-DNA d. supercoiled e. B-DNA 5. Why might a single base-pair mutation in eukaryotic mRNA be less serious than one in prokaryotic mRNA? a. If the mutation occurs in the exon, it will not affect the gene product. b. If the mutation occurs in the 3′ end of the start site, it will not affect the gene product. c. If the...

  • 1. Create the primers to amplify the gene of interest. 1. Below is almost the full...

    1. Create the primers to amplify the gene of interest. 1. Below is almost the full sequence of the coding strand of the F9 gene (exon 2-exon4) that you found in the online database (NCBI, Genomic sequence F9 gene). Some of the sequence is missing, but you know how many nucleotides are skipped. Design forward and reverse primers 18nt each for PCR that will isolate EXACTLY the sequence that is in bold typeface. Exon 2 = 164 nt Intron 2...

ADVERTISEMENT
Free Homework Help App
Download From Google Play
Scan Your Homework
to Get Instant Free Answers
Need Online Homework Help?
Ask a Question
Get Answers For Free
Most questions answered within 3 hours.
ADVERTISEMENT
ADVERTISEMENT