Question

3. A map is shown below for a gene that uses alternative splicing. 5 splice sites are indicated with a 5, while 3 splice sites are indicated with a .3. Boxes below the gene are used to represent the presence of sequence elements found in the pre-mRNA for this gene. Splicing enhancers are shown as filled boxes, while splicing silencers are shown as stippled boxes. The enhancers and silencers only act on the splice site that they overlap (eg, the stippled box affects the 3 splice site at B/C). In the absence of activators and/or repressors, you can assume that the 5 and 3 splice sites closest to each other will always be used. Each potential gene segment is given a letter. Use the letter code to answer the following questions. For example, if the only splicing that occurred was between the AB 5 and B/C 3 splice site, the product would be written as: ACDEFGH. 5 3 3 a. What does the mRNA from this gene look like in the absence of splicing activators and repressors? b. What does the mRNA from this gene look like in the presence of only splicing activators? c. What does the mRNA from this gene look like in the presence of only splicing repressors? d. If you could ADD or REMOVE any splicing enhancers or silencers in the pre-mRNA, describe how you could get the pre- mRNA to splice to make an AH mRNA (you may assume that any required activators or repressors are present).
0 0
Add a comment Improve this question Transcribed image text
Answer #1

In molecular biology splicing is the editing of the nascent precursor mRNAtranscript.after splicing,Introns are removed and Exons are joined together.Some transcription factors activate transcription i.e they may help the general transcription factors and RNA POLYMERASE bind to the promoter whereas a represser may get in the way of the basal transcription factors or RNA polymerase,making it so they can not bind to the promoter or begin transcription

Add a comment
Know the answer?
Add Answer to:
A map is shown below for a gene that uses alternative splicing. 5 splice sites are...
Your Answer:

Post as a guest

Your Name:

What's your source?

Earn Coins

Coins can be redeemed for fabulous gifts.

Not the answer you're looking for? Ask your own homework help question. Our experts will answer your question WITHIN MINUTES for Free.
Similar Homework Help Questions
  • Draw a Eukaryotic Gene Schematic Draw features of importance at the DNA level Transcription start site...

    Draw a Eukaryotic Gene Schematic Draw features of importance at the DNA level Transcription start site +1 Promoter - as much detail as you can Gene start ATG and stop codons Transcription Regulatory Sequences such as activators/repressors and enhancers/insulators Draw features of importance at the pre-mRNA level Designate Introns and Exons Designate important Sequences to direct and regulate splicing three important sequences for the chemistry of splicing splicing regulatory sequences (ISS, ISE, ESE, ESS) Modifications at level of pre-mRNA UTRs,...

  • Hello! I am working on this genetics problem and was wondering if these two answers would...

    Hello! I am working on this genetics problem and was wondering if these two answers would make sense. Thank you for the help! Question 1 (1 point) Saved Why can bacteria have poly-cistronic genes? Because they need multiple cistron organelles so they segregate evenly during cell division. Because they have many exons that are joined together before translation Because ribosomes can be loaded at multiple Shine Delgano/AUG sequences. Because ribosomes are loaded at the single CAP site. Because the stability...

  • 3of 3 9. The figure below represents the primary transcript of a gene that contains four exons (A, B, C, D) and two introns. The dark block in exon B indicates the position of an additional stop...

    3of 3 9. The figure below represents the primary transcript of a gene that contains four exons (A, B, C, D) and two introns. The dark block in exon B indicates the position of an additional stop codon; the normal start and stop codons for translation are present in exons A and D respectively. The two arrows indicate alternative 3' splice sites for the first intron Pre-mRNA 5'I 3' intron intron Give a schematic representation of the mature mRNAs that...

  • 1. A sequence of a eukaryotic gene (coding strand) is shown below, RNA polymerase recognizes the...

    1. A sequence of a eukaryotic gene (coding strand) is shown below, RNA polymerase recognizes the sequence ‘TATAAT’ and initiates transcription six nucleotides downstream of the sequence. The in tron splice sites are CUU (5’ splice site) and AAG (3’ splice site), poly -A tails are added following the sequence AGUUGG. The poly- A tails are 20 nucleotides. a. Predict the sequence of mature mRNA and denote 5’ and 3’ ends. b. If this is an oncogene that is elevated...

  • A sequence of a eukaryotic gene (coding strand) is shown below, RNA polymerase recognizes the sequence...

    A sequence of a eukaryotic gene (coding strand) is shown below, RNA polymerase recognizes the sequence ‘TATAAT’ and initiates transcription six nucleotides downstream of the sequence. The intron splice sites are CUU (5’ splice site) and AAG (3’ splice site), poly-A tails are added following the sequence AGUUGG. The poly-A tails are 20 nucleotides. b. If this is an oncogene that is elevated in cancer cells, design two siRNAs to knock down the mRNA, list the sequences of the siRNAs...

  • 5. A eukaryotic protein-encoding gene contains two introns and three exons: exon 1–intron 1–exon 2–intron 2–exon...

    5. A eukaryotic protein-encoding gene contains two introns and three exons: exon 1–intron 1–exon 2–intron 2–exon 3. The 5ʹ splice site at the boundary between exon 2 and intron 2 has been eliminated by a small deletion in the gene. Describe how the pre-mRNA encoded by this mutant gene would be spliced. Indicate which introns and exons would be found in the mRNA after splicing occurs

  • What does the 5 prime cap on the mature mRNA consist of? (Choose all that apply)...

    What does the 5 prime cap on the mature mRNA consist of? (Choose all that apply) cap proteins backwards, methylated G nucleotide polyA tail ribosome QUESTION 7 Which DNA regions are necessary to specify removal of an intron? (choose all that apply) cleavage site branch point 5' splice site 3' splice site U-rich sequence QUESTION 9 Which of the following can permit a single gene to produce several different proteins? (choose all that apply) multiple 5' capping sites alternative splicing...

  • 4. You have partial transcriptomis data for a human gene and want to revise the annotation...

    4. You have partial transcriptomis data for a human gene and want to revise the annotation in the human genome. TITLE_EL Your data is shown below. Exons are boxes and introns are dotted lines. a. Which introns are constitutive? b. Which transcripts show an intron retention? c. Which transcripts show competing 5' splice sites? Which transcripts show competing 3' spice sites? e. If mRNA isoform 1 is used to annotate the genome of this gene, does it best represent all...

  • QUESTION 1 Which of the following statements regarding splicing is FALSE?        A) The length...

    QUESTION 1 Which of the following statements regarding splicing is FALSE?        A) The length of introns determines the efficiency of splicing. B) Many human neurological disorders are caused by splicing errors and/or mutations in splicing factors.        C) Splicing requires the action of a variety of snRNAs that direct the transesterification reactions.        D) Splicing is dictated by sequence features in pre-mRNA transcripts QUESTION 2 Which of the following mRNA processing factors does NOT associate with...

  • Questions 11-15: Gene structure/Splicing problem. "Protein X" consists of a total of 431 amino acids. Your...

    Questions 11-15: Gene structure/Splicing problem. "Protein X" consists of a total of 431 amino acids. Your colleague, techniques) the a biochemist, has purified the protein and determined (via complicated and messy chemical sequence of the first 37 amino acids in the protein, which she has reported to you as follows: HN- MSNITVDDELNLSREQQGFAEDDFIVIKEERETSLSP . nwhile, you have isolated a genomic clone of the gene that codes for protein X, and determined the DNA equence of the first 227 bases from the...

ADVERTISEMENT
Free Homework Help App
Download From Google Play
Scan Your Homework
to Get Instant Free Answers
Need Online Homework Help?
Ask a Question
Get Answers For Free
Most questions answered within 3 hours.
ADVERTISEMENT
ADVERTISEMENT