Question

Identify the product(s) when the peptide Y-A-R-N is added to the trypsin at pH=7. (answer can...

Identify the product(s) when the peptide Y-A-R-N is added to the trypsin at pH=7. (answer can be more than one choice)

Y-A-R-N

Y

A

R

N

A-R-N

R-N

Y-A-R

Y-A

0 0
Add a comment Improve this question Transcribed image text
Answer #1

Trypsin cuts arginine and lysine residues at the C-terminal of peptide chain.

The given peptide is

Tyrosine-alanine-arginine-asparagine

Conventionally, a polypeptide chain run in N---->C direction.

Therefore, the products of trypsin digestion for the given peptide chain would be Y-A-R- and N.

Add a comment
Know the answer?
Add Answer to:
Identify the product(s) when the peptide Y-A-R-N is added to the trypsin at pH=7. (answer can...
Your Answer:

Post as a guest

Your Name:

What's your source?

Earn Coins

Coins can be redeemed for fabulous gifts.

Not the answer you're looking for? Ask your own homework help question. Our experts will answer your question WITHIN MINUTES for Free.
Similar Homework Help Questions
  • A) Draw the dipeptide R-T at pH 7 and CLEARLY label the peptide bond to be...

    A) Draw the dipeptide R-T at pH 7 and CLEARLY label the peptide bond to be broken in the presence of trypsin. 3pts B) Draw the five-step mechanism for the trypsin cleavage of the dipeptide. 5pts C) Label the transition state each time it is formed. 1pt D) What mechanism is used to describe this bisubstrate reaction? 1 pt

  • consider the small peptide Y-R-P-N a) draw the entire peptide, with charges you would expect on...

    consider the small peptide Y-R-P-N a) draw the entire peptide, with charges you would expect on it at pH 7.4. b) tabulate the charge on the molecule at every pH between 1 and 13 c) calculate the pI for the peptide d) what is the overall charge on the peptide at ph 1? ph 7.4? ph 13? e) do you expect this peptide to absorb at 280 nm? why or why not? f) Mark all the chiral centers in the...

  • 2. (7 pts) What is the sequence of the following HEXAPEPTIDE? *PROVIDE WORK/ANSWER for B-F! (Use...

    2. (7 pts) What is the sequence of the following HEXAPEPTIDE? *PROVIDE WORK/ANSWER for B-F! (Use deductive reasoning) Observations from Sequencing Experiments: A. The Sequence contains the following amino acids: Y, R, M, K, G,D B. Reaction with 1-fluoro-2,4-dinitrobenzene yielded DNP-G. C. Treatment with chymotrypsin yielded two tripeptides. D. Treatment with trypsin yielded three dipeptides. E. Treatment with carboxypeptidase yielded methionine. F. N-terminal sequencing of one of the chymotrypsin-produced tripeptides yielded DNP-K Explanation and summary of protein sequencing techniques •...

  • (7 pts) What is the sequence of the following HEXAPEPTIDE? *PROVIDE WORK/ANSWER for B-F! (Use deductive...

    (7 pts) What is the sequence of the following HEXAPEPTIDE? *PROVIDE WORK/ANSWER for B-F! (Use deductive reasoning) Observations from Sequencing Experiments: A. The Sequence contains the following amino acids: Y, R, M, K, G, D B. Reaction with 1-fluoro-2,4-dinitrobenzene yielded DNP-G. ___ ___ ___ ____ ___ ___ y = 0.058x + 0.0081 y = 0.2711x + 0.0105 -0.02 0 0.02 0.04 0.06 0.08 0.1 0.12 0.14 -0.2 -0.1 0 0.1 0.2 0.3 0.4 0.5 Velocity ( mM/min) -1 [S] mM-1...

  • Can anyone confirm if these are correct? List and draw the structure(s) the amino acid(s) in...

    Can anyone confirm if these are correct? List and draw the structure(s) the amino acid(s) in which would have a-1 net charge at pH? List the amino acid(s) in which would have a + 1 net charge at pH 7? Draw the structure- of the peptide Arg-Asp-His-Ser-Gly at pH 7. List the N-terminus and C-terminus. Make sure the amide bonds are 'trans'. Give the products of a trypsin digestion of the peptide: His-phe-lys-val-asp-asp-arg-val Draw the full structure of the predominant...

  • Identify the major product(s) in the reaction of (R)-2-bromopentane with sodium cyanide in DMSO. Please draw...

    Identify the major product(s) in the reaction of (R)-2-bromopentane with sodium cyanide in DMSO. Please draw the correct answer choice with its stereochemistry. 6) Identify the major product(s) in the reaction of (R)-2-bromopentane with sodium cyanide in DMSO. Please draw the correct answer choice with its stereochemistry. A) B) C) D) (S)-2-cyanopentane racemic mixture of 2-cyanopentane (R)-2-cyanopentane trans-2-pentene

  • Imagine that you have just isolated a peptide hormone with the following primary sequence: MLSCRLQEALAALSKIVLADLGCVTGAPSDPR (Assume...

    Imagine that you have just isolated a peptide hormone with the following primary sequence: MLSCRLQEALAALSKIVLADLGCVTGAPSDPR (Assume the protein is in solution at physiological pH, and remember to include the amino acids at each end of the chain. A charge may come from the R-group, the N-terminus, and/or the C-terminus. If a residue occurs more than once, include each one in your answer.) List the residues (individual amino acids) that contribute a positive charge: ​ List the residues that contribute a...

  • Please explain each part !! Thank you !! #3. Under experimental conditions, you purify a known,...

    Please explain each part !! Thank you !! #3. Under experimental conditions, you purify a known, biologically important peptide from human tissue. To determine the overall sequence, you then digest the pure peptide with trypsin and chymotrypsin (each separately) and then use mass spectrometry to identify the following sequence fragments from the overall peptide (shown in order of relative length, not necessarily in the order in which they are assembled in the whole, natural peptide). Trypsin cleavage products: Chymotrypsin cleavage...

  • sults in more than one other product being 7. Product-cost subsidization means that: A) when one...

    sults in more than one other product being 7. Product-cost subsidization means that: A) when one product is overcosted, it results in more than overcosfed B) when a company undercosts more than one of its than one of its other products when a company undercosts one of its products, it will overcosta other products ) when one product is overcosted it result in all other products being o costs more than one of its products, it will overcost more e...

  • Identify the major and minor product(s) of the following reaction:

    Practice Problem 07.76f Identify the major and minor product(s) of the following reaction: If there is more than one minor product, be sure to draw all of them.

ADVERTISEMENT
Free Homework Help App
Download From Google Play
Scan Your Homework
to Get Instant Free Answers
Need Online Homework Help?
Ask a Question
Get Answers For Free
Most questions answered within 3 hours.
ADVERTISEMENT
ADVERTISEMENT