Question

1) A protein is 435 amino acids long, which of the genes below COULD NOT code...

1) A protein is 435 amino acids long, which of the genes below COULD NOT code for this protein?

A cancer causing gene (an oncogene) that is 990 nucleotides long

A 3321 nucleotide long histone gene

A transposon gene that is 1435 nucleotides long

A heart muscle gene, 4317 nucleotides long

2) PCR can be used to amplify a single gene

True

False

0 0
Add a comment Improve this question Transcribed image text
Answer #1

Answer

1) Option A is the right answer as for coding of a gene of 435 amino acid, the nucleotides should be (435 X3)= 1305 or above but in this option gene size is 990 which can code for the given gene.

2) PCR can be used to amplify a single gene is a TRUE statement as PCR is meant for amplification of the specific gene.

Add a comment
Know the answer?
Add Answer to:
1) A protein is 435 amino acids long, which of the genes below COULD NOT code...
Your Answer:

Post as a guest

Your Name:

What's your source?

Earn Coins

Coins can be redeemed for fabulous gifts.

Not the answer you're looking for? Ask your own homework help question. Our experts will answer your question WITHIN MINUTES for Free.
Similar Homework Help Questions
  • DNA, Genes and Protein Synthesis Activity 13: Protein Synthesis is the process by which cells produce (synthesize) proteins. An overview of the process is shown in model 2 (below). Gone 2...

    DNA, Genes and Protein Synthesis Activity 13: Protein Synthesis is the process by which cells produce (synthesize) proteins. An overview of the process is shown in model 2 (below). Gone 2 Gene 1 Gene 3 DNA strand3 TRANSLATION Protein Trp Gly Model 2 ACTIVITY and QUESTIONS 1. Based on the information you can gather from model 1 complete the following sentences: a. The nucleotide Adenine (A) always pairs with the nucleotide b. The nucleotide Guanine (G) always pairs with the...

  • 1. the genes that seem to be the most necessary to maintain, since they are present...

    1. the genes that seem to be the most necessary to maintain, since they are present in the smallest cellular organisms are a. cytoskeletal protein genes b, translation protein genes c. replication protein genes d. transcription protein genes e. DNA repair protein genes 2. Why do cellular organisms generally look very similar when early embryos but different from each other when mature? a. their DNAs have different chemistry b. their RNAs are different lengths c. what genes get turned on...

  • QUESTION 7 If the MC1R protein is 317 amino acids long why are there 954 base...

    QUESTION 7 If the MC1R protein is 317 amino acids long why are there 954 base pairs in the coding region of the gene? Each amino acid has a mRNA codon and DNA triplet consisting of a three-base sequence. (317 x 3951 plus a stop codon (951-3-954) to signal the end of translation) Because there are 317 proteins in the MC1R code. mutant proteins always have 954 base pairs. Each amino acid has a mRNA codon and DNA triplet consisting...

  • The genetic code is "redundant" because: Question 1 options: Each amino acid is specified by only...

    The genetic code is "redundant" because: Question 1 options: Each amino acid is specified by only a single codon Most amino acids are specified by multiple codons Codons are groups of four consecutive DNA bases Each codon can specify multiple amino acids Question 2 (1 point) A mutation in the DNA may not result in change in protein function because: Question 2 options: Many different amino acids share similar chemical properties, so can substitute for one another without altering function...

  • The genetic code is "redundant" because: Question 1 options: Each amino acid is specified by only...

    The genetic code is "redundant" because: Question 1 options: Each amino acid is specified by only a single codon Most amino acids are specified by multiple codons Codons are groups of four consecutive DNA bases Each codon can specify multiple amino acids Question 2 (1 point) A mutation in the DNA may not result in change in protein function because: Question 2 options: Many different amino acids share similar chemical properties, so can substitute for one another without altering function...

  • Questions 11-15: Gene structure/Splicing problem. "Protein X" consists of a total of 431 amino acids. Your...

    Questions 11-15: Gene structure/Splicing problem. "Protein X" consists of a total of 431 amino acids. Your colleague, techniques) the a biochemist, has purified the protein and determined (via complicated and messy chemical sequence of the first 37 amino acids in the protein, which she has reported to you as follows: HN- MSNITVDDELNLSREQQGFAEDDFIVIKEERETSLSP . nwhile, you have isolated a genomic clone of the gene that codes for protein X, and determined the DNA equence of the first 227 bases from the...

  • Please help with 4-10! DNA, Genes,and Protein Synthesis Activity 13: 2. The bases that interact with each other are called complementary bases. this definition and your answers to 1 complete th...

    Please help with 4-10! DNA, Genes,and Protein Synthesis Activity 13: 2. The bases that interact with each other are called complementary bases. this definition and your answers to 1 complete the following: a. Thiamine (T) is the complementary base of b. Cytosine (C) is the complementary base of c. Adenine (A) is the complementary base of d. Guanine (G) is the complementary base of Based on 3. Shown below is the nucleotide sequence for one strand of a stretch of...

  • 1. Transcription occurs in the a. Nucleus. b. Ribosomes of the Rough Endoplasmic Reticulum. c. Mitochondrion....

    1. Transcription occurs in the a. Nucleus. b. Ribosomes of the Rough Endoplasmic Reticulum. c. Mitochondrion. d. Cell membrane. e. Smooth Endoplasmic Reticulum. 2. The monomers of DNA and RNA are a. amino acids. b. monosaccharides. c. nucleotides. d. fatty acids. e. nucleic acids. 3. Which of the following statements regarding DNA is false? a. DNA uses the nitrogenous base uracil. b. DNA is a nucleic acid. c. One DNA molecule can include four different nucleotides in its structure. d....

  • DNA DNA Replication: ONA Because DNA Is the ge m Tumes and heart e ine in...

    DNA DNA Replication: ONA Because DNA Is the ge m Tumes and heart e ine in process called DNA curs in the nucleus of s acest FS Parent strand Parent strand Newly replicated DNA Newly replicated DNA- SA0 Daughter DNA molecule Daughter DNA molecule Figure 8.2: Overview of DNA replication and illustration of complementary base pairing. DNA must replicate before cell division so that each new daughter cell receives an exact copy of the parent DNA. 1. Replication begins when...

  • ____ 1. The diagram below represents serine, a polar, uncharged amino acid. Which functional group gives...

    ____ 1. The diagram below represents serine, a polar, uncharged amino acid. Which functional group gives serine its distinct property? a. H3 b. CH2OH c. –H d. COO– ____ 2. The monomers shown below are monomers for which of the following natural polymers? a. polysaccharides b. plastics c. DNA d. proteins ____ 3. Which of the following processes illustrates the production of a protein? a. specific code for amino acids --> amino acid chain --> gene --> DNA --> specific...

ADVERTISEMENT
Free Homework Help App
Download From Google Play
Scan Your Homework
to Get Instant Free Answers
Need Online Homework Help?
Ask a Question
Get Answers For Free
Most questions answered within 3 hours.
ADVERTISEMENT
ADVERTISEMENT