Question

A hypothetical protein is associated with certain types of cancers. It consists of 10 amino acids...


A hypothetical protein is associated with certain types of cancers. It consists of 10 amino acids arranged in a straight line, with the distance between each adjacent amino acid equal to 1 micron. The masses of the amino acids range between 10 and 100 AMU. Compute the position of the centre of mass of the protein in the given coordinate system.

0 0
Add a comment Improve this question Transcribed image text
Know the answer?
Add Answer to:
A hypothetical protein is associated with certain types of cancers. It consists of 10 amino acids...
Your Answer:

Post as a guest

Your Name:

What's your source?

Earn Coins

Coins can be redeemed for fabulous gifts.

Not the answer you're looking for? Ask your own homework help question. Our experts will answer your question WITHIN MINUTES for Free.
Similar Homework Help Questions
  • a hypothetical protein is associated with certain types of cancer. it consists of 10 amino acids...

    a hypothetical protein is associated with certain types of cancer. it consists of 10 amino acids arranged in a straight line, with the distance between each adjacent amino acid equal to 1 u(micron). the masses of the amino acids range between 10 -100 AMU. compute the position of the center of mass of the protein in the given coordinate system

  • help with 10 and 11 10. In protein structure, adjacent amino acids are connected to each...

    help with 10 and 11 10. In protein structure, adjacent amino acids are connected to each other through amide bonds. i) Draw any three amino acids connected via amide bond. (7 pts) ii) Highlight the amide bonds in 10. i) (3 pts) 11. Briefly explain the differences between alpha-helix and beta-pleated sheets in Secondary structure of proteins. (10 pts)

  • Questions 11-15: Gene structure/Splicing problem. "Protein X" consists of a total of 431 amino acids. Your...

    Questions 11-15: Gene structure/Splicing problem. "Protein X" consists of a total of 431 amino acids. Your colleague, techniques) the a biochemist, has purified the protein and determined (via complicated and messy chemical sequence of the first 37 amino acids in the protein, which she has reported to you as follows: HN- MSNITVDDELNLSREQQGFAEDDFIVIKEERETSLSP . nwhile, you have isolated a genomic clone of the gene that codes for protein X, and determined the DNA equence of the first 227 bases from the...

  • 6) Proteins are composed of amino acids polymerized into long chains. The structure of a protein...

    6) Proteins are composed of amino acids polymerized into long chains. The structure of a protein - that is, its overall shape and how the chains are "folded” around each other - is very important for its function. In an aqueous environment, in an active, folded state the hydrophilic amino acids in the protein are facing outwards exposed to the water and the hydrophobic amino acids are hidden away from the water in the core of the protein. In a...

  • Essential, or indispensable amino acids, must be consumed in the diet. All of the following are...

    Essential, or indispensable amino acids, must be consumed in the diet. All of the following are essential amino acids except methionine. alanine. isoleucine. lysine. Why might consuming a vegetarian diet reduce your risk of heart disease? Plant sources of protein are lower in saturated fatty acids and cholesterol than are animal protein sources. Plant sources of protein are lower in unsaturated fatty acids than are animal protein sources. Plant sources of protein have less fiber than do animal protein sources....

  • 11 Department of Biological Sciences BIOCHEMISTRY Test 2.2018 H. Nucleic Acid, Sequencing of DNA: Amino Acids...

    11 Department of Biological Sciences BIOCHEMISTRY Test 2.2018 H. Nucleic Acid, Sequencing of DNA: Amino Acids Hydrolysis of salt Laboratory buffers, Polyprotie acids QUESTIONS 1. The DNA strand complementary to the strand 3-GTAGCGTAT-Y' would have the sequence a SLTACOCATAT-3 b.3.CATOXICATA-S c. 3-ATGCGTATA-S" ATATGCGTAS 2. When cytosine is treated with bisulfite, the amino group is replaced with a carbonyl group. Identify the resulting base a. adenine b. guanine c uracil d. thyminee. typoxanthine 3. How many amino acids would be in...

  • 5. (9pts) You are studying an ER membrane protein, YFG1 (outlined in yellow), with three transmembrane...

    5. (9pts) You are studying an ER membrane protein, YFG1 (outlined in yellow), with three transmembrane domains (rectangles A, B & C at the amino acid positions according to the following map, connected by soluble domains (wavy lines): N-term 10 10 Com Amino acid position (not to scale) 30 60 80 140 160 310 ABCI YFG1 alkaline phosphatase To determine how the protein is arranged in the ER membrane, you construct a series of shortened YFG1 proteins that are connected...

  • I added everything thing. this is the lab question you need to solve. First assigned buffer...

    I added everything thing. this is the lab question you need to solve. First assigned buffer pH: 2.031 Second assigned buffer pH: 9.171 Available Buffer Systems (acid/ base) pka of Conjugate Acid 2.847 4.757 malonic acid/ monosodium malonate acetic acid/ sodium acetate ammonium chloride/ ammonia triethylammonium chloride/ triethylamine 9.244 10.715 1) Buffer system details: Given pH Name and volume conjugate acid Name and volume conjugate base 2) Calculations for preparation of high capacity buffer system. Introduction In this experiment, you...

  • 1. According to the paper, what does lactate dehydrogenase (LDH) do and what does it allow...

    1. According to the paper, what does lactate dehydrogenase (LDH) do and what does it allow to happen within the myofiber? (5 points) 2. According to the paper, what is the major disadvantage of relying on glycolysis during high-intensity exercise? (5 points) 3. Using Figure 1 in the paper, briefly describe the different sources of ATP production at 50% versus 90% AND explain whether you believe this depiction of ATP production applies to a Type IIX myofiber in a human....

  • 10. Write a one-page summary of the attached paper? INTRODUCTION Many problems can develop in activated...

    10. Write a one-page summary of the attached paper? INTRODUCTION Many problems can develop in activated sludge operation that adversely affect effluent quality with origins in the engineering, hydraulic and microbiological components of the process. The real "heart" of the activated sludge system is the development and maintenance of a mixed microbial culture (activated sludge) that treats wastewater and which can be managed. One definition of a wastewater treatment plant operator is a "bug farmer", one who controls the aeration...

ADVERTISEMENT
Free Homework Help App
Download From Google Play
Scan Your Homework
to Get Instant Free Answers
Need Online Homework Help?
Ask a Question
Get Answers For Free
Most questions answered within 3 hours.
ADVERTISEMENT
ADVERTISEMENT