a hypothetical protein is associated with certain types of cancer. it consists of 10 amino acids arranged in a straight line, with the distance between each adjacent amino acid equal to 1 u(micron). the masses of the amino acids range between 10 -100 AMU. compute the position of the center of mass of the protein in the given coordinate system
a hypothetical protein is associated with certain types of cancer. it consists of 10 amino acids...
A hypothetical protein is associated with certain types of cancers. It consists of 10 amino acids arranged in a straight line, with the distance between each adjacent amino acid equal to 1 micron. The masses of the amino acids range between 10 and 100 AMU. Compute the position of the centre of mass of the protein in the given coordinate system.
help with 10 and 11
10. In protein structure, adjacent amino acids are connected to each other through amide bonds. i) Draw any three amino acids connected via amide bond. (7 pts) ii) Highlight the amide bonds in 10. i) (3 pts) 11. Briefly explain the differences between alpha-helix and beta-pleated sheets in Secondary structure of proteins. (10 pts)
Questions 11-15: Gene structure/Splicing problem. "Protein X" consists of a total of 431 amino acids. Your colleague, techniques) the a biochemist, has purified the protein and determined (via complicated and messy chemical sequence of the first 37 amino acids in the protein, which she has reported to you as follows: HN- MSNITVDDELNLSREQQGFAEDDFIVIKEERETSLSP . nwhile, you have isolated a genomic clone of the gene that codes for protein X, and determined the DNA equence of the first 227 bases from the...
6) Proteins are composed of amino acids polymerized into long chains. The structure of a protein - that is, its overall shape and how the chains are "folded” around each other - is very important for its function. In an aqueous environment, in an active, folded state the hydrophilic amino acids in the protein are facing outwards exposed to the water and the hydrophobic amino acids are hidden away from the water in the core of the protein. In a...
Essential, or indispensable amino acids, must be consumed in the diet. All of the following are essential amino acids except methionine. alanine. isoleucine. lysine. Why might consuming a vegetarian diet reduce your risk of heart disease? Plant sources of protein are lower in saturated fatty acids and cholesterol than are animal protein sources. Plant sources of protein are lower in unsaturated fatty acids than are animal protein sources. Plant sources of protein have less fiber than do animal protein sources....
11 Department of Biological Sciences BIOCHEMISTRY Test 2.2018 H. Nucleic Acid, Sequencing of DNA: Amino Acids Hydrolysis of salt Laboratory buffers, Polyprotie acids QUESTIONS 1. The DNA strand complementary to the strand 3-GTAGCGTAT-Y' would have the sequence a SLTACOCATAT-3 b.3.CATOXICATA-S c. 3-ATGCGTATA-S" ATATGCGTAS 2. When cytosine is treated with bisulfite, the amino group is replaced with a carbonyl group. Identify the resulting base a. adenine b. guanine c uracil d. thyminee. typoxanthine 3. How many amino acids would be in...
5. (9pts) You are studying an ER membrane protein, YFG1 (outlined in yellow), with three transmembrane domains (rectangles A, B & C at the amino acid positions according to the following map, connected by soluble domains (wavy lines): N-term 10 10 Com Amino acid position (not to scale) 30 60 80 140 160 310 ABCI YFG1 alkaline phosphatase To determine how the protein is arranged in the ER membrane, you construct a series of shortened YFG1 proteins that are connected...
can
u tell me if these answers are correct please!??!!!
Choose the best answer for the following questions. Place your answer on the line. If your answer is not on the line.it does not count 1 Mender's discovery that characteristics are inherited due to the transmission of hereditary factors resulted from his (1) dissections to determine how fertilization occurs in pea plants (2analysis of the offspring produced from many pea plant crosses (3) careful microscopic examinations of genes and chromosomes...
change pas channels in the volta t ive protein to change shape. This A of the S l e terminal siste oplasmic reticum calcio p r eneule warcoplasm reticulum sodium ions m o nster transverse tubules sarcolemma: calcium ions Saroplasmic reticum: triadsarcolemma: calcium ions sons bind to This causes a change in shape and exposing C D E Calcium vesicle tylcholine action potential Sodium sarcolemma calcium on myosin heads Sodium sacoplasmic reticulum calcium ions actin 15. An attaches to exposed...
I added everything thing.
this is the lab question you need to solve.
First assigned buffer pH: 2.031 Second assigned buffer pH: 9.171 Available Buffer Systems (acid/ base) pka of Conjugate Acid 2.847 4.757 malonic acid/ monosodium malonate acetic acid/ sodium acetate ammonium chloride/ ammonia triethylammonium chloride/ triethylamine 9.244 10.715 1) Buffer system details: Given pH Name and volume conjugate acid Name and volume conjugate base 2) Calculations for preparation of high capacity buffer system. Introduction In this experiment, you...