Imagine you want to study one of the human crystallins, proteins present in the lens of the eye. To obtain sufficient amount of the protein of interest, you decide to clone the gene that codes for it. Assume you know the sequence of this gene. How would you go about this? In a paragraph of approximately 3 to 5 complete logical sentences, explain the technique that you would use, why, and its basic steps.
To answer this question you need to state whether the following statement is true or false and state two reasons why you think so:
A eukaryotic gene, beginning at its transcription start site and ending at its transcription termination site, that is 90,000 bases long will lead to a protein that is 30,000 amino acids long.
The statement is false. As the protein formation only start from the start codon (AUG) and ends at the STOP codon (UAA, UAG, UGA), and do not depend on the transcription start/ termination site, the protein formed can never be same size as the mRNA sequence size. It will always be shorter than mRNA size.
The human genome has a lot of non-coding sequences present in the genes required for gene regulation. The eukaryotic genes contain exons and introns, which upon splicing of mRNA results in the cutting of introns and joining of exons, form a protein. eg if a gene is 90,000 bp long, only 1% of that sequence may be exon and rest is introns.
As mentioned earlier, the mature mRNA is formed after many post-transcriptional modifications like splicing. So for cloning of human crystallin proteins,
Imagine you want to study one of the human crystallins, proteins present in the lens of...
Scientists have engineered bacteria to produce human proteins such as human growth hormone (hGH) to help treat dwarfism. Suppose the unmodified eukaryotic gene coding for hGH is inserted directly into a bacterial chromosome. Select the reasons why no expression would be seen in the bacterial cell for the hGH gene. Bacteria cannot remove intronic sequence from a gene, so if the gene for hGH were transcribed, it would translate to a nonfunctional protein. The bacterial nucleoid does not have the...
where does transcription begin
3. List the major types of RNA and include what they code for, their function in the cell and which type is translated. 4. If a bacterial protein has 2,500 amino acids long, how many nucleotide pairs long is the ger sequence that codes for it? 5. Where does transcription begin? 6. What is the template and nontemplate strands of DNA? 7. Why is only one strand transcribed, and is the same strand of DNA always...
Questions 11-15: Gene structure/Splicing problem. "Protein X" consists of a total of 431 amino acids. Your colleague, techniques) the a biochemist, has purified the protein and determined (via complicated and messy chemical sequence of the first 37 amino acids in the protein, which she has reported to you as follows: HN- MSNITVDDELNLSREQQGFAEDDFIVIKEERETSLSP . nwhile, you have isolated a genomic clone of the gene that codes for protein X, and determined the DNA equence of the first 227 bases from the...
Question 2: Transcription, RNA Processing and Translation A particular gene codes for a mature mRNA transcript containing 1200 bases, which is translated into a protein containing 300 amino acids. A. How long is the coding sequence in this mRNA and how many nucleotides are in the UTRs? For the purposes of this question we are ignoring the G’ cap and the polyA tail. B. A mutant form of the gene created by one nucleotide being changed to another nucleotide also...
want to double check!
25. Th e DNA sequences encoding the initiation whese parated bcoding the initiation and termination codons of a certain protein amino acids in length. there of the protei nucleotides on a certain organism's chromosome; however ssuming that there has been no post-translational processing elined from this gene is translated, the protein product is only 250 A. The RNA was synthesized in a bacterial cell n, what can you conclude from these observations? The RNA was synthesized...
The observation that in any DNA sample, A T and G C A. DNase sequencing An analytical method that determines which segments of DNA are bound by a particular B. Chargaff's rule protein factor, such as a transcription factor C. ChIP sequencing D. Euchromatin E. Histone acetylation F. major groove - # Areas associated with a eukaryotic gene that are where most DNA methylation occurs. # An analytical technique that involves a small slide or chip with many segments of...
Several blastocoel cavities of early embryos from black mice are injected with the cells you chose. The blastocyst is then transferred to a pseudopregnant white mouse. You get the following pups. Which of the following would you use to continue the experiment? A brown and black mouse A pink mouse A white mouse A black mouse 1 points QUESTION 3 Knowing that the neomycin resistance gene that you used for the knockout construct is 3 kb in length and knowing that...
6) Proteins are composed of amino acids polymerized into long chains. The structure of a protein - that is, its overall shape and how the chains are "folded” around each other - is very important for its function. In an aqueous environment, in an active, folded state the hydrophilic amino acids in the protein are facing outwards exposed to the water and the hydrophobic amino acids are hidden away from the water in the core of the protein. In a...
DNA, Genes and Protein Synthesis Activity 13: Protein Synthesis is the process by which cells produce (synthesize) proteins. An overview of the process is shown in model 2 (below). Gone 2 Gene 1 Gene 3 DNA strand3 TRANSLATION Protein Trp Gly Model 2 ACTIVITY and QUESTIONS 1. Based on the information you can gather from model 1 complete the following sentences: a. The nucleotide Adenine (A) always pairs with the nucleotide b. The nucleotide Guanine (G) always pairs with the...
DNA DNA Replication: ONA Because DNA Is the ge m Tumes and heart e ine in process called DNA curs in the nucleus of s acest FS Parent strand Parent strand Newly replicated DNA Newly replicated DNA- SA0 Daughter DNA molecule Daughter DNA molecule Figure 8.2: Overview of DNA replication and illustration of complementary base pairing. DNA must replicate before cell division so that each new daughter cell receives an exact copy of the parent DNA. 1. Replication begins when...