Question

What do we call the bond between amino acids in the linear sequence of a protein?...

What do we call the bond between amino acids in the linear sequence of a protein? (one word)

0 0
Add a comment Improve this question Transcribed image text
Answer #1

Peptide bond.

The bond between two amino acids formed due to condensation reaction and removal of water to form a dipeptide is called a peptide bond. polypeptide with addition of more amino acids are joined together by peptide bonds.

Add a comment
Know the answer?
Add Answer to:
What do we call the bond between amino acids in the linear sequence of a protein?...
Your Answer:

Post as a guest

Your Name:

What's your source?

Earn Coins

Coins can be redeemed for fabulous gifts.

Not the answer you're looking for? Ask your own homework help question. Our experts will answer your question WITHIN MINUTES for Free.
Similar Homework Help Questions
  • 19. The _structure of a protein refers to the linear sequence of amino acids in that...

    19. The _structure of a protein refers to the linear sequence of amino acids in that protein. 20. Make up an example of the primary structure of a protein in the space below 21. The structure of a protein refers to a regular, recurring arrangement of the amino acid chain. One such arrangement, called the occurs when the amino acid chain forms a spiral or coil. Draw an example of this structure in the space below. 22. Another type of_...

  • 1. What type of bond is formed between the amino acids of a protein? a. Peptide...

    1. What type of bond is formed between the amino acids of a protein? a. Peptide b. Nucleopeptide c. Condensation d. Catalyst 2. A dipeptide has how many amino acids? 3. Which of the following is true about the functions of protein? A. proteins are required to metabolize fat B. proteins help buffer acids in the body C. proteins are the primary energy source for the body? D. all of the above 4. What is the recommended range of daily...

  • We will refer to the protein as sequence2. It was just 40 amino acids long and...

    We will refer to the protein as sequence2. It was just 40 amino acids long and had the following amino acid sequence >sequence2 MSAEALADPAADPLAGNNPDADPEAINLKAIAALAKALLG Using your knowledge of BLAST searching particularly “Protein BLAST” (http://blast.ncbi.nlm.nih.gov/Blast.cgi?PROGRAM=blastp&PAGE_TYPE=BlastSearch&LINK_LOC=blasthome), the Expasy (http://www.expasy.org/) and the BLASTP align2seq (http://blast.ncbi.nlm.nih.gov/Blast.cgi?PAGE_TYPE=BlastSearch&BLAST_SPEC=blast2seq&LINK_LOC=align2seq ) Answer the following questions: a) What is the identity score between the query protein sequence (i.e. sequence2) and the highest scoring (best) aligning sequence from the BLAST search? (1 mark) b) Using similarity to other species as...

  • The primary structure of a protein is formed by the condensation of amino acids in a...

    The primary structure of a protein is formed by the condensation of amino acids in a certain sequence. Consider the dipeptide formed by the condensation of glycine and tyrosine in Figure 8.31B. a. Draw the structure of the dipeptide that would be formed if the two amino acids condensed in the opposite sequence. b. How are the structures of the dipeptides in Figure 8.31B and your drawing related to each other? B 0 HN-C-0--OH HO H-N-C-C-OH H CHE H OH...

  • What type of bonds/interactions can be formed between two amino acids in a protein? [Select all...

    What type of bonds/interactions can be formed between two amino acids in a protein? [Select all that apply] A. peptide bond B. hydrogen bond C. metallic bonds D. sulfur bridges E. salt bridges

  • Below, you can find a partial sequence of last 30 amino acids of a certain protein...

    Below, you can find a partial sequence of last 30 amino acids of a certain protein (amino acids, single-letter code). There are also mutated sequences of the same protein. Explain which mutations could have happened. (pay attention to the sequence length and the sequence itself) (25) Original                 GVLSEGEWQLVLHVWAKVEADVAGHGQDIL Mutant 1             GVLSEGEWQLVLHV Mutant 2             GVLSEGEWQLVHVWAKVEADVAGHGQDIL Mutant 3             GVLQHDAWQLVLHVWAKVEADVAGHGQDIL Mutant 4             GVLSEGEWQLVLHVWAKVEAWLWVMGHEVMLQ Mutant 5             GVLSEGEWQLVLHVWAKVEADVAGHGQDILWALWQAEVGQLIGH

  • Given a protein amino acid sequence (written out, 1 letter abbreviation, about 700 amino acids), how...

    Given a protein amino acid sequence (written out, 1 letter abbreviation, about 700 amino acids), how do i identify the N and C terminals? I know that N terminal is a free amine group and C is a free carboxyl group, but how do i know it is free? How do i identify it?

  • Protein Structure A protein contains a string of amino acids (usually more than 50) that has...

    Protein Structure A protein contains a string of amino acids (usually more than 50) that has a biological function. 15ecause proteins are so large, their structure has several levels, all of which are important for the proper functioning of the protein. Ultimately, the sequence of amino acids (ordering of polar and nonpolar amino acids) dictates the 3-dimensional shape of a protein and this dictates its primary function. Level 1: Primary (1") The amino acid sequence of a polypeptide Protein Backbone...

  • You are studying an interesting protein in nematode worms that is 100 amino acids in length....

    You are studying an interesting protein in nematode worms that is 100 amino acids in length. Of particular interest is the fact that the last seven amino acids are all tryptophan (codons 94 through 100). Draw here the mRNA sequence for codons 94-100: Draw here the sequence of the DNA strand RNA polymerase used as its template (show 5' 3' polarity): You mutagenize the wild type worm. Assume for the next questions you are able to isolate both normal and...

  • After translating sequence X to a protein sequence, you have determined the first five amino acids...

    After translating sequence X to a protein sequence, you have determined the first five amino acids are: Sequence X GAGCCACAGGTACAACGACGAACGCGGCTGCATTATTATTATTTTATTTCCCCGCTCCGTGGACATGCAA ATTAACCCGCGATCAGTGTGTGCCCGCAACCCAGCTGCATTGAATTGAGTTATCCCGAATCCCGCATCCC GCGTAGAGATCAAAAGACCAGCAGCAATATGGACCAGATGCTCAGCCCCAACTTCTCGATTCCGAGCATC GGAACGCCGCTGCACCAGATGGAGGCAGACCAGCAGATTGTGGCCAATCCGGTCTACCATCCGCCGGCGG TGCCGCAGCCGGATCCGGTGATGCCGGCCCCGGTTTCCGGCTCCGTGCAGCAACAGCAACCGGACACCAG CGGATCCGGTCTCTTTGGCCACGAACCATCGATCCCGCTGGCCCACAAGCAAATGCAAAGCTACCAGCCA TCGGCGTCCTATCAGCAGCAGCAGCAGCAGCTCCAGAGTCAGGCGCCCGGCGGCGGTGGGAGCACCCCGC AGTCCATGATGCAGCCCCAGACACCGCAGAGCATGATGGCACACATGATGCCCATGAGCGAGCGCAGTGT GGGCGGATCGGGATCGGGAGCGGGCAGCGGCGGAGACGGCCTCAGCAACATACACCAGACAATGGGACCC TCCACGCCGATGACACCTGCCACGCCGGGATCGGCAGATCCCGGGATTGTCCCACAACTGCAGAACATTG TGTCCACGGTGAATCTGTGCTGCAAGCTGGACCTCAAGAAGATAGCGCTGCACGCGAGGAACGCCGAGTA CAACCCCAAGCGATTTGCGGCCGTCATAATGCGCATCAGGGAGCCAAGAACCACTGCCCTGATCTTCAGC TCCGGCAAGATGGTGTGCACGGGGGCTAAGAGCGAGGACGACTCCAGATTGGCGGCGAGAAAGTACGCGC GCATCATTCAGAAGCTAGGTTTCCCTGCCAAATTCCTCGACTTCAAGATTCAGAACATGGTCGGCTCCTG TGATGTCAAGTTCCCCATCCGCTTGGAAGGCCTGGTGCTGACCCATTGCAACTTCAGCAGCTACGAGCCG GAGCTTTTCCCCGGCCTCATCTACCGTATGGTGCGCCCTCGCATCGTGCTGCTCATCTTCGTGTCCGGGA AAGTGGTGCTCACGGGCGCCAAGGTGCGACAGGAGATCTACGATGCCTTCGACAAGATATTCCCCATATT GAAAAAGTTCAAGAAGCAGTCATAAATAGGATAGTGCTTTATTAGTTCTGTACGTGTACGTGTTAGGGTC GGTAGTTCCGGAAGTCTGATTGTGAGGTGGGAGCAGCCTGGCGAGCAGCTCCGATCGAGAATAAACAAAA ACTAGTTAGCTGTA

ADVERTISEMENT
Free Homework Help App
Download From Google Play
Scan Your Homework
to Get Instant Free Answers
Need Online Homework Help?
Ask a Question
Get Answers For Free
Most questions answered within 3 hours.
ADVERTISEMENT
ADVERTISEMENT