What do we call the bond between amino acids in the linear sequence of a protein?...
What do we call the bond between amino acids in the linear sequence of a protein? (one word)
Homework Answers
Peptide bond.
The bond between two amino acids formed due to condensation reaction and removal of water to form a dipeptide is called a peptide bond. polypeptide with addition of more amino acids are joined together by peptide bonds.
Add Answer to:
What do we call the bond between amino acids in the linear
sequence of a protein?...
19. The _structure of a protein refers to the linear sequence of amino acids in that...
19. The _structure of a protein refers to the linear sequence of amino acids in that protein. 20. Make up an example of the primary structure of a protein in the space below 21. The structure of a protein refers to a regular, recurring arrangement of the amino acid chain. One such arrangement, called the occurs when the amino acid chain forms a spiral or coil. Draw an example of this structure in the space below. 22. Another type of_...
1. What type of bond is formed between the amino acids of a protein? a. Peptide...
1. What type of bond is formed between the amino acids of a protein? a. Peptide b. Nucleopeptide c. Condensation d. Catalyst 2. A dipeptide has how many amino acids? 3. Which of the following is true about the functions of protein? A. proteins are required to metabolize fat B. proteins help buffer acids in the body C. proteins are the primary energy source for the body? D. all of the above 4. What is the recommended range of daily...
We will refer to the protein as sequence2. It was just 40 amino acids long and...
We will refer to the protein as sequence2. It was just 40 amino acids long and had the following amino acid sequence >sequence2 MSAEALADPAADPLAGNNPDADPEAINLKAIAALAKALLG Using your knowledge of BLAST searching particularly “Protein BLAST” (http://blast.ncbi.nlm.nih.gov/Blast.cgi?PROGRAM=blastp&PAGE_TYPE=BlastSearch&LINK_LOC=blasthome), the Expasy (http://www.expasy.org/) and the BLASTP align2seq (http://blast.ncbi.nlm.nih.gov/Blast.cgi?PAGE_TYPE=BlastSearch&BLAST_SPEC=blast2seq&LINK_LOC=align2seq ) Answer the following questions: a) What is the identity score between the query protein sequence (i.e. sequence2) and the highest scoring (best) aligning sequence from the BLAST search? (1 mark) b) Using similarity to other species as...
The primary structure of a protein is formed by the condensation of amino acids in a...
The primary structure of a protein is formed by the condensation of amino acids in a certain sequence. Consider the dipeptide formed by the condensation of glycine and tyrosine in Figure 8.31B. a. Draw the structure of the dipeptide that would be formed if the two amino acids condensed in the opposite sequence. b. How are the structures of the dipeptides in Figure 8.31B and your drawing related to each other? B 0 HN-C-0--OH HO H-N-C-C-OH H CHE H OH...
What type of bonds/interactions can be formed between two amino acids in a protein? [Select all...
What type of bonds/interactions can be formed between two amino acids in a protein? [Select all that apply] A. peptide bond B. hydrogen bond C. metallic bonds D. sulfur bridges E. salt bridges
Below, you can find a partial sequence of last 30 amino acids of a certain protein...
Below, you can find a partial sequence of last 30 amino acids of a certain protein (amino acids, single-letter code). There are also mutated sequences of the same protein. Explain which mutations could have happened. (pay attention to the sequence length and the sequence itself) (25) Original GVLSEGEWQLVLHVWAKVEADVAGHGQDIL Mutant 1 GVLSEGEWQLVLHV Mutant 2 GVLSEGEWQLVHVWAKVEADVAGHGQDIL Mutant 3 GVLQHDAWQLVLHVWAKVEADVAGHGQDIL Mutant 4 GVLSEGEWQLVLHVWAKVEAWLWVMGHEVMLQ Mutant 5 GVLSEGEWQLVLHVWAKVEADVAGHGQDILWALWQAEVGQLIGH
Given a protein amino acid sequence (written out, 1 letter abbreviation, about 700 amino acids), how...
Given a protein amino acid sequence (written out, 1 letter abbreviation, about 700 amino acids), how do i identify the N and C terminals? I know that N terminal is a free amine group and C is a free carboxyl group, but how do i know it is free? How do i identify it?
Protein Structure A protein contains a string of amino acids (usually more than 50) that has...
Protein Structure A protein contains a string of amino acids (usually more than 50) that has a biological function. 15ecause proteins are so large, their structure has several levels, all of which are important for the proper functioning of the protein. Ultimately, the sequence of amino acids (ordering of polar and nonpolar amino acids) dictates the 3-dimensional shape of a protein and this dictates its primary function. Level 1: Primary (1") The amino acid sequence of a polypeptide Protein Backbone...
You are studying an interesting protein in nematode worms that is 100 amino acids in length....
You are studying an interesting protein in nematode worms that is 100 amino acids in length. Of particular interest is the fact that the last seven amino acids are all tryptophan (codons 94 through 100). Draw here the mRNA sequence for codons 94-100: Draw here the sequence of the DNA strand RNA polymerase used as its template (show 5' 3' polarity): You mutagenize the wild type worm. Assume for the next questions you are able to isolate both normal and...
After translating sequence X to a protein sequence, you have determined the first five amino acids...
After translating sequence X to a protein sequence, you have determined the first five amino acids are: Sequence X GAGCCACAGGTACAACGACGAACGCGGCTGCATTATTATTATTTTATTTCCCCGCTCCGTGGACATGCAA ATTAACCCGCGATCAGTGTGTGCCCGCAACCCAGCTGCATTGAATTGAGTTATCCCGAATCCCGCATCCC GCGTAGAGATCAAAAGACCAGCAGCAATATGGACCAGATGCTCAGCCCCAACTTCTCGATTCCGAGCATC GGAACGCCGCTGCACCAGATGGAGGCAGACCAGCAGATTGTGGCCAATCCGGTCTACCATCCGCCGGCGG TGCCGCAGCCGGATCCGGTGATGCCGGCCCCGGTTTCCGGCTCCGTGCAGCAACAGCAACCGGACACCAG CGGATCCGGTCTCTTTGGCCACGAACCATCGATCCCGCTGGCCCACAAGCAAATGCAAAGCTACCAGCCA TCGGCGTCCTATCAGCAGCAGCAGCAGCAGCTCCAGAGTCAGGCGCCCGGCGGCGGTGGGAGCACCCCGC AGTCCATGATGCAGCCCCAGACACCGCAGAGCATGATGGCACACATGATGCCCATGAGCGAGCGCAGTGT GGGCGGATCGGGATCGGGAGCGGGCAGCGGCGGAGACGGCCTCAGCAACATACACCAGACAATGGGACCC TCCACGCCGATGACACCTGCCACGCCGGGATCGGCAGATCCCGGGATTGTCCCACAACTGCAGAACATTG TGTCCACGGTGAATCTGTGCTGCAAGCTGGACCTCAAGAAGATAGCGCTGCACGCGAGGAACGCCGAGTA CAACCCCAAGCGATTTGCGGCCGTCATAATGCGCATCAGGGAGCCAAGAACCACTGCCCTGATCTTCAGC TCCGGCAAGATGGTGTGCACGGGGGCTAAGAGCGAGGACGACTCCAGATTGGCGGCGAGAAAGTACGCGC GCATCATTCAGAAGCTAGGTTTCCCTGCCAAATTCCTCGACTTCAAGATTCAGAACATGGTCGGCTCCTG TGATGTCAAGTTCCCCATCCGCTTGGAAGGCCTGGTGCTGACCCATTGCAACTTCAGCAGCTACGAGCCG GAGCTTTTCCCCGGCCTCATCTACCGTATGGTGCGCCCTCGCATCGTGCTGCTCATCTTCGTGTCCGGGA AAGTGGTGCTCACGGGCGCCAAGGTGCGACAGGAGATCTACGATGCCTTCGACAAGATATTCCCCATATT GAAAAAGTTCAAGAAGCAGTCATAAATAGGATAGTGCTTTATTAGTTCTGTACGTGTACGTGTTAGGGTC GGTAGTTCCGGAAGTCTGATTGTGAGGTGGGAGCAGCCTGGCGAGCAGCTCCGATCGAGAATAAACAAAA ACTAGTTAGCTGTA
19. The _structure of a protein refers to the linear sequence of amino acids in that protein. 20. Make up an example of the primary structure of a protein in the space below 21. The structure of a protein refers to a regular, recurring arrangement of the amino acid chain. One such arrangement, called the occurs when the amino acid chain forms a spiral or coil. Draw an example of this structure in the space below. 22. Another type of_...
The primary structure of a protein is formed by the condensation of amino acids in a certain sequence. Consider the dipeptide formed by the condensation of glycine and tyrosine in Figure 8.31B. a. Draw the structure of the dipeptide that would be formed if the two amino acids condensed in the opposite sequence. b. How are the structures of the dipeptides in Figure 8.31B and your drawing related to each other? B 0 HN-C-0--OH HO H-N-C-C-OH H CHE H OH...
Protein Structure A protein contains a string of amino acids (usually more than 50) that has a biological function. 15ecause proteins are so large, their structure has several levels, all of which are important for the proper functioning of the protein. Ultimately, the sequence of amino acids (ordering of polar and nonpolar amino acids) dictates the 3-dimensional shape of a protein and this dictates its primary function. Level 1: Primary (1") The amino acid sequence of a polypeptide Protein Backbone...
You are studying an interesting protein in nematode worms that is 100 amino acids in length. Of particular interest is the fact that the last seven amino acids are all tryptophan (codons 94 through 100). Draw here the mRNA sequence for codons 94-100: Draw here the sequence of the DNA strand RNA polymerase used as its template (show 5' 3' polarity): You mutagenize the wild type worm. Assume for the next questions you are able to isolate both normal and...
Most questions answered within 3 hours.
-
Where is the error in this code sequence?
String s1 = "Hello";
String s2 = "ello";...
asked 10 months ago -
Financial data for Joel de Paris, Inc., for last year
follow:
Joel de Paris, Inc.
Balance...
asked 10 months ago -
Consider this reaction:
Al2(SO4)3 (aq)+ BaCl3
(aq) Al2Cl6 (aq)- +
3BaSO4(s) . What is the...
asked 10 months ago -
Suppose that Savneet is considering increasing her
recent random sample from 20 car rentals to 40...
asked 10 months ago -
Trucks arrive at an unloading terminal at an average rate of 120
per hour.
Trucks arrive...
asked 10 months ago -
Why are methanol and ethanol completely soluble in water while
octanol is not very little soluble....
asked 10 months ago -
A facilities manager at a university reads in a research report
that the mean amount of...
asked 10 months ago -
When the CuSO4 is rehydrated by adding water to the anhydrous
compound, is this an endothermic...
asked 10 months ago -
A ray of sunlight is passing from diamond into crown glass; the
angle of incidence is...
asked 10 months ago -
A block of mass 0.249 kg is placed on top of a light, vertical
spring of...
asked 10 months ago -
how do the kidneys compensate in the presences of acidosis
a) trigger hyperventilate
b) reserve acid...
asked 10 months ago -
Question 501 pts
The rental rate of capital to the firm increases. Which of the
following...
asked 10 months ago