After translating sequence X to a protein sequence, you have determined the first five amino acids...
After translating sequence X to a protein sequence, you have determined the first five amino acids are:
Sequence X
GAGCCACAGGTACAACGACGAACGCGGCTGCATTATTATTATTTTATTTCCCCGCTCCGTGGACATGCAA
ATTAACCCGCGATCAGTGTGTGCCCGCAACCCAGCTGCATTGAATTGAGTTATCCCGAATCCCGCATCCC
GCGTAGAGATCAAAAGACCAGCAGCAATATGGACCAGATGCTCAGCCCCAACTTCTCGATTCCGAGCATC
GGAACGCCGCTGCACCAGATGGAGGCAGACCAGCAGATTGTGGCCAATCCGGTCTACCATCCGCCGGCGG
TGCCGCAGCCGGATCCGGTGATGCCGGCCCCGGTTTCCGGCTCCGTGCAGCAACAGCAACCGGACACCAG
CGGATCCGGTCTCTTTGGCCACGAACCATCGATCCCGCTGGCCCACAAGCAAATGCAAAGCTACCAGCCA
TCGGCGTCCTATCAGCAGCAGCAGCAGCAGCTCCAGAGTCAGGCGCCCGGCGGCGGTGGGAGCACCCCGC
AGTCCATGATGCAGCCCCAGACACCGCAGAGCATGATGGCACACATGATGCCCATGAGCGAGCGCAGTGT
GGGCGGATCGGGATCGGGAGCGGGCAGCGGCGGAGACGGCCTCAGCAACATACACCAGACAATGGGACCC
TCCACGCCGATGACACCTGCCACGCCGGGATCGGCAGATCCCGGGATTGTCCCACAACTGCAGAACATTG
TGTCCACGGTGAATCTGTGCTGCAAGCTGGACCTCAAGAAGATAGCGCTGCACGCGAGGAACGCCGAGTA
CAACCCCAAGCGATTTGCGGCCGTCATAATGCGCATCAGGGAGCCAAGAACCACTGCCCTGATCTTCAGC
TCCGGCAAGATGGTGTGCACGGGGGCTAAGAGCGAGGACGACTCCAGATTGGCGGCGAGAAAGTACGCGC
GCATCATTCAGAAGCTAGGTTTCCCTGCCAAATTCCTCGACTTCAAGATTCAGAACATGGTCGGCTCCTG
TGATGTCAAGTTCCCCATCCGCTTGGAAGGCCTGGTGCTGACCCATTGCAACTTCAGCAGCTACGAGCCG
GAGCTTTTCCCCGGCCTCATCTACCGTATGGTGCGCCCTCGCATCGTGCTGCTCATCTTCGTGTCCGGGA
AAGTGGTGCTCACGGGCGCCAAGGTGCGACAGGAGATCTACGATGCCTTCGACAAGATATTCCCCATATT
GAAAAAGTTCAAGAAGCAGTCATAAATAGGATAGTGCTTTATTAGTTCTGTACGTGTACGTGTTAGGGTC
GGTAGTTCCGGAAGTCTGATTGTGAGGTGGGAGCAGCCTGGCGAGCAGCTCCGATCGAGAATAAACAAAA
ACTAGTTAGCTGTA
Homework Answers
As this sequence is containing T base so it is DNA sequence . Firstly we need to make RNA sequence from it . And we need only first five amino acids so we will be focussing on first 15 bases.
Add Answer to:
After translating sequence X to a protein sequence, you have
determined the first five amino acids...
If you have an enzyme that has a primary sequence that is 429 amino acids in...
If you have an enzyme that has a primary sequence that is 429 amino acids in length, is it possible that both an amino acid position 215, as well as amino acids located at 342, and 401, can all be part of an active site of a protein? Explain why or why not?
Below, you can find a partial sequence of last 30 amino acids of a certain protein...
Below, you can find a partial sequence of last 30 amino acids of a certain protein (amino acids, single-letter code). There are also mutated sequences of the same protein. Explain which mutations could have happened. (pay attention to the sequence length and the sequence itself) (25) Original GVLSEGEWQLVLHVWAKVEADVAGHGQDIL Mutant 1 GVLSEGEWQLVLHV Mutant 2 GVLSEGEWQLVHVWAKVEADVAGHGQDIL Mutant 3 GVLQHDAWQLVLHVWAKVEADVAGHGQDIL Mutant 4 GVLSEGEWQLVLHVWAKVEAWLWVMGHEVMLQ Mutant 5 GVLSEGEWQLVLHVWAKVEADVAGHGQDILWALWQAEVGQLIGH
Questions 11-15: Gene structure/Splicing problem. "Protein X" consists of a total of 431 amino acids. Your...
Questions 11-15: Gene structure/Splicing problem. "Protein X" consists of a total of 431 amino acids. Your colleague, techniques) the a biochemist, has purified the protein and determined (via complicated and messy chemical sequence of the first 37 amino acids in the protein, which she has reported to you as follows: HN- MSNITVDDELNLSREQQGFAEDDFIVIKEERETSLSP . nwhile, you have isolated a genomic clone of the gene that codes for protein X, and determined the DNA equence of the first 227 bases from the...
You are studying an interesting protein in nematode worms that is 100 amino acids in length....
You are studying an interesting protein in nematode worms that is 100 amino acids in length. Of particular interest is the fact that the last seven amino acids are all tryptophan (codons 94 through 100). Draw here the mRNA sequence for codons 94-100: Draw here the sequence of the DNA strand RNA polymerase used as its template (show 5' 3' polarity): You mutagenize the wild type worm. Assume for the next questions you are able to isolate both normal and...
QU. 5. You have identified the complete amino acid sequence on protein sequencing techniques. "Y" is...
QU. 5. You have identified the complete amino acid sequence on protein sequencing techniques. "Y" is composed of 44 amino acids with the po below. No information is available about its genetic sequence. Your task sequence for protein "Y". Assume that the gene sequence is unique in the human 5 BRIEFLY EXPLAIN methodically and accurately how you will decipher the gene seg "Y". (3 POINTS). no acid sequence of a human protein called "Y" using 1.44 amino acids with the...
As a scientist, you hypothesize that a particular sequence of amino acids leads to localization in...
As a scientist, you hypothesize that a particular sequence of amino acids leads to localization in the inner mitochondria membrane. How could you test this using a non-mitochondrial cytosolic protein? Include the following components in your answer. Hypothesis: Sequence X leads to localization in the inner mitochondrial membrane Experimental Control: Experimental Protein: Method (s): Result/Analysis:
15. Determine the amino acids following mRNA molecules. ne the amino acid sequence a ribosome would...
15. Determine the amino acids following mRNA molecules. ne the amino acid sequence a ribosome would translate from the *GCACCAUGCAAAGCGGGGAUUAGACCUUU-3 Caution: from which end of the RNA strand does the ribosome begin translating? 3-AGAGUCCAUGCAAAGCGGGGAUUGUACCUUU - 5' 16. Determine the amino acid sequence a ribosome would translate from the following non template DNA strand. (Hint: you must first convert the non template DNA strand to a template DNA strand and then to mRNAJ 3'-ACCTTGATCCTTGACGTATGTAGTATGTATC-5'
19. The _structure of a protein refers to the linear sequence of amino acids in that...
19. The _structure of a protein refers to the linear sequence of amino acids in that protein. 20. Make up an example of the primary structure of a protein in the space below 21. The structure of a protein refers to a regular, recurring arrangement of the amino acid chain. One such arrangement, called the occurs when the amino acid chain forms a spiral or coil. Draw an example of this structure in the space below. 22. Another type of_...
What do we call the bond between amino acids in the linear sequence of a protein?...
What do we call the bond between amino acids in the linear sequence of a protein? (one word)
The DNA sequence shown encodes the last amino acids of a protein that has a total...
The DNA sequence shown encodes the last amino acids of a protein that has a total of 270 amino acids. The bolded base pairs indicate the translation reading frame. 5’ …….GCT AAG TAT TGC TCA AGA TTA GGA TGA TAA ATA ACT TGG 3’ 3’ …….CGA TTA ATA ACG AGT TCT AAT CCT ACT ATT TAT TGA ACC 5’ Which is the template strand for transcription? Explain.
Questions 11-15: Gene structure/Splicing problem. "Protein X" consists of a total of 431 amino acids. Your colleague, techniques) the a biochemist, has purified the protein and determined (via complicated and messy chemical sequence of the first 37 amino acids in the protein, which she has reported to you as follows: HN- MSNITVDDELNLSREQQGFAEDDFIVIKEERETSLSP . nwhile, you have isolated a genomic clone of the gene that codes for protein X, and determined the DNA equence of the first 227 bases from the...
You are studying an interesting protein in nematode worms that is 100 amino acids in length. Of particular interest is the fact that the last seven amino acids are all tryptophan (codons 94 through 100). Draw here the mRNA sequence for codons 94-100: Draw here the sequence of the DNA strand RNA polymerase used as its template (show 5' 3' polarity): You mutagenize the wild type worm. Assume for the next questions you are able to isolate both normal and...
QU. 5. You have identified the complete amino acid sequence on protein sequencing techniques. "Y" is composed of 44 amino acids with the po below. No information is available about its genetic sequence. Your task sequence for protein "Y". Assume that the gene sequence is unique in the human 5 BRIEFLY EXPLAIN methodically and accurately how you will decipher the gene seg "Y". (3 POINTS). no acid sequence of a human protein called "Y" using 1.44 amino acids with the...
15. Determine the amino acids following mRNA molecules. ne the amino acid sequence a ribosome would translate from the *GCACCAUGCAAAGCGGGGAUUAGACCUUU-3 Caution: from which end of the RNA strand does the ribosome begin translating? 3-AGAGUCCAUGCAAAGCGGGGAUUGUACCUUU - 5' 16. Determine the amino acid sequence a ribosome would translate from the following non template DNA strand. (Hint: you must first convert the non template DNA strand to a template DNA strand and then to mRNAJ 3'-ACCTTGATCCTTGACGTATGTAGTATGTATC-5'
19. The _structure of a protein refers to the linear sequence of amino acids in that protein. 20. Make up an example of the primary structure of a protein in the space below 21. The structure of a protein refers to a regular, recurring arrangement of the amino acid chain. One such arrangement, called the occurs when the amino acid chain forms a spiral or coil. Draw an example of this structure in the space below. 22. Another type of_...
Most questions answered within 3 hours.
-
Where is the error in this code sequence?
String s1 = "Hello";
String s2 = "ello";...
asked 10 months ago -
Financial data for Joel de Paris, Inc., for last year
follow:
Joel de Paris, Inc.
Balance...
asked 10 months ago -
Consider this reaction:
Al2(SO4)3 (aq)+ BaCl3
(aq) Al2Cl6 (aq)- +
3BaSO4(s) . What is the...
asked 10 months ago -
Suppose that Savneet is considering increasing her
recent random sample from 20 car rentals to 40...
asked 10 months ago -
Trucks arrive at an unloading terminal at an average rate of 120
per hour.
Trucks arrive...
asked 10 months ago -
Why are methanol and ethanol completely soluble in water while
octanol is not very little soluble....
asked 10 months ago -
A facilities manager at a university reads in a research report
that the mean amount of...
asked 10 months ago -
When the CuSO4 is rehydrated by adding water to the anhydrous
compound, is this an endothermic...
asked 10 months ago -
A ray of sunlight is passing from diamond into crown glass; the
angle of incidence is...
asked 10 months ago -
A block of mass 0.249 kg is placed on top of a light, vertical
spring of...
asked 10 months ago -
how do the kidneys compensate in the presences of acidosis
a) trigger hyperventilate
b) reserve acid...
asked 10 months ago -
Question 501 pts
The rental rate of capital to the firm increases. Which of the
following...
asked 10 months ago