After translating sequence X to a protein sequence, you have determined the first five amino acids are:
Sequence X
GAGCCACAGGTACAACGACGAACGCGGCTGCATTATTATTATTTTATTTCCCCGCTCCGTGGACATGCAA
ATTAACCCGCGATCAGTGTGTGCCCGCAACCCAGCTGCATTGAATTGAGTTATCCCGAATCCCGCATCCC
GCGTAGAGATCAAAAGACCAGCAGCAATATGGACCAGATGCTCAGCCCCAACTTCTCGATTCCGAGCATC
GGAACGCCGCTGCACCAGATGGAGGCAGACCAGCAGATTGTGGCCAATCCGGTCTACCATCCGCCGGCGG
TGCCGCAGCCGGATCCGGTGATGCCGGCCCCGGTTTCCGGCTCCGTGCAGCAACAGCAACCGGACACCAG
CGGATCCGGTCTCTTTGGCCACGAACCATCGATCCCGCTGGCCCACAAGCAAATGCAAAGCTACCAGCCA
TCGGCGTCCTATCAGCAGCAGCAGCAGCAGCTCCAGAGTCAGGCGCCCGGCGGCGGTGGGAGCACCCCGC
AGTCCATGATGCAGCCCCAGACACCGCAGAGCATGATGGCACACATGATGCCCATGAGCGAGCGCAGTGT
GGGCGGATCGGGATCGGGAGCGGGCAGCGGCGGAGACGGCCTCAGCAACATACACCAGACAATGGGACCC
TCCACGCCGATGACACCTGCCACGCCGGGATCGGCAGATCCCGGGATTGTCCCACAACTGCAGAACATTG
TGTCCACGGTGAATCTGTGCTGCAAGCTGGACCTCAAGAAGATAGCGCTGCACGCGAGGAACGCCGAGTA
CAACCCCAAGCGATTTGCGGCCGTCATAATGCGCATCAGGGAGCCAAGAACCACTGCCCTGATCTTCAGC
TCCGGCAAGATGGTGTGCACGGGGGCTAAGAGCGAGGACGACTCCAGATTGGCGGCGAGAAAGTACGCGC
GCATCATTCAGAAGCTAGGTTTCCCTGCCAAATTCCTCGACTTCAAGATTCAGAACATGGTCGGCTCCTG
TGATGTCAAGTTCCCCATCCGCTTGGAAGGCCTGGTGCTGACCCATTGCAACTTCAGCAGCTACGAGCCG
GAGCTTTTCCCCGGCCTCATCTACCGTATGGTGCGCCCTCGCATCGTGCTGCTCATCTTCGTGTCCGGGA
AAGTGGTGCTCACGGGCGCCAAGGTGCGACAGGAGATCTACGATGCCTTCGACAAGATATTCCCCATATT
GAAAAAGTTCAAGAAGCAGTCATAAATAGGATAGTGCTTTATTAGTTCTGTACGTGTACGTGTTAGGGTC
GGTAGTTCCGGAAGTCTGATTGTGAGGTGGGAGCAGCCTGGCGAGCAGCTCCGATCGAGAATAAACAAAA
ACTAGTTAGCTGTA
As this sequence is containing T base so it is DNA sequence . Firstly we need to make RNA sequence from it . And we need only first five amino acids so we will be focussing on first 15 bases.

After translating sequence X to a protein sequence, you have determined the first five amino acids...
If you have an enzyme that has a primary sequence that is 429 amino acids in length, is it possible that both an amino acid position 215, as well as amino acids located at 342, and 401, can all be part of an active site of a protein? Explain why or why not?
Below, you can find a partial sequence of last 30 amino acids of a certain protein (amino acids, single-letter code). There are also mutated sequences of the same protein. Explain which mutations could have happened. (pay attention to the sequence length and the sequence itself) (25) Original GVLSEGEWQLVLHVWAKVEADVAGHGQDIL Mutant 1 GVLSEGEWQLVLHV Mutant 2 GVLSEGEWQLVHVWAKVEADVAGHGQDIL Mutant 3 GVLQHDAWQLVLHVWAKVEADVAGHGQDIL Mutant 4 GVLSEGEWQLVLHVWAKVEAWLWVMGHEVMLQ Mutant 5 GVLSEGEWQLVLHVWAKVEADVAGHGQDILWALWQAEVGQLIGH
Questions 11-15: Gene structure/Splicing problem. "Protein X" consists of a total of 431 amino acids. Your colleague, techniques) the a biochemist, has purified the protein and determined (via complicated and messy chemical sequence of the first 37 amino acids in the protein, which she has reported to you as follows: HN- MSNITVDDELNLSREQQGFAEDDFIVIKEERETSLSP . nwhile, you have isolated a genomic clone of the gene that codes for protein X, and determined the DNA equence of the first 227 bases from the...
You are studying an interesting protein in nematode worms that is 100 amino acids in length. Of particular interest is the fact that the last seven amino acids are all tryptophan (codons 94 through 100). Draw here the mRNA sequence for codons 94-100: Draw here the sequence of the DNA strand RNA polymerase used as its template (show 5' 3' polarity): You mutagenize the wild type worm. Assume for the next questions you are able to isolate both normal and...
QU. 5. You have identified the complete amino acid sequence on protein sequencing techniques. "Y" is composed of 44 amino acids with the po below. No information is available about its genetic sequence. Your task sequence for protein "Y". Assume that the gene sequence is unique in the human 5 BRIEFLY EXPLAIN methodically and accurately how you will decipher the gene seg "Y". (3 POINTS). no acid sequence of a human protein called "Y" using 1.44 amino acids with the...
As a scientist, you hypothesize that a particular sequence of amino acids leads to localization in the inner mitochondria membrane. How could you test this using a non-mitochondrial cytosolic protein? Include the following components in your answer. Hypothesis: Sequence X leads to localization in the inner mitochondrial membrane Experimental Control: Experimental Protein: Method (s): Result/Analysis:
15. Determine the amino acids following mRNA molecules. ne the amino acid sequence a ribosome would translate from the *GCACCAUGCAAAGCGGGGAUUAGACCUUU-3 Caution: from which end of the RNA strand does the ribosome begin translating? 3-AGAGUCCAUGCAAAGCGGGGAUUGUACCUUU - 5' 16. Determine the amino acid sequence a ribosome would translate from the following non template DNA strand. (Hint: you must first convert the non template DNA strand to a template DNA strand and then to mRNAJ 3'-ACCTTGATCCTTGACGTATGTAGTATGTATC-5'
19. The _structure of a protein refers to the linear sequence of amino acids in that protein. 20. Make up an example of the primary structure of a protein in the space below 21. The structure of a protein refers to a regular, recurring arrangement of the amino acid chain. One such arrangement, called the occurs when the amino acid chain forms a spiral or coil. Draw an example of this structure in the space below. 22. Another type of_...
What do we call the bond between amino acids in the linear sequence of a protein? (one word)
The DNA sequence shown encodes the last amino acids of a protein that has a total of 270 amino acids. The bolded base pairs indicate the translation reading frame. 5’ …….GCT AAG TAT TGC TCA AGA TTA GGA TGA TAA ATA ACT TGG 3’ 3’ …….CGA TTA ATA ACG AGT TCT AAT CCT ACT ATT TAT TGA ACC 5’ Which is the template strand for transcription? Explain.