HomeworkLib
Question

3. Below is the sequence of a protein you are interested in GAAQTNAPWGLARISSTSPGTSTYYYDESAGQGSCVYVIDTGIEASHPEF EGRAQMVKTYYYSS

science   biology   
0 0
Add a comment Improve this question Transcribed image text
Next > < Previous
Sort answers by oldest

Homework Answers

Answer #1

The sequence is

GAAQTNAPWGLARISSTAPGTSTYYYDDESAGQGSCVYVIDTGIEASHPEFEGRAQMVKTYYYSSRDGNGHGTHCAGTVGSATYGVAKKTQLFGVKLDDNGSGQYSTIIAGMDFVASDKNNRNCPKGVVASLSLGGGYSSSVNSAAARLQSSGVMVMVMVAAGNNNADARNYSPASSVCTVGASDRYDRRSSFSNYGSVLDIFGPGTSILSTWIGGSTRSISGTSMATPHVAGLAAYMTLGKTTAASACRYIADTAMKGDLSNIPFGTVNLLAYNNYQA

No. Of amino acids = 279

Molecular weight: 28846.88

Theoretical pI: 7.77

Ext. coefficient    36330 per mole per cm
Abs 0.1% (=1 g/l)   1.259, assuming all Cys residues are reduced

Protein concentration = 0.427 mg/ml

please find the solution in the figure below.

Absorbance at λmax Extinction coefficient x Pathlength 0.5 x 28847 g/mol x 1 33740 M-1cm -1 × 1 cm Concentration 0.427 mg/mL

0 0
Add a comment
Know the answer?
Add Answer to:
3. Below is the sequence of a protein you are interested in GAAQTNAPWGLARISSTSPGTSTYYYDESAGQGSCVYVIDTGIEASHPEF EGRAQMVKTYYYSSRDGNGHGTHCAGTVGSRTYGVAKKTQLFGVKVLDDN GSGQYSTIIAGMDFVASDKNNRNCPKGVVASLSLGGG...
Your Answer:

Post as a guest

Your Name:

What's your source?

Earn Coins

Coins can be redeemed for fabulous gifts.

Log In

Sign Up

Not the answer you're looking for? Ask your own homework help question. Our experts will answer your question WITHIN MINUTES for Free.
Similar Homework Help Questions

  • Which of the following pentapeptides will exhibit the highest extinction coefficient at 280 nm? Assume that...

    Which of the following pentapeptides will exhibit the highest extinction coefficient at 280 nm? Assume that each tryptophan has an extinction coefficient of 5690 M-1cm-1, tyrosine has an extinction coefficient of 1280 M-1cm-1, and the absorbance of phenylalanine at 280 nm is negligible. TEDSE #TYWSF RYYFE FEWFE The UV-vis absorption spectrum of the peptide RYYFE collected in a 1 cm pathlength cuvette exhibits an absorbance of 0.050 at 280 nm. What is the concentration (in micromolar) of the peptide in...

  • Please answer both 1. Often when handling proteins, we use concentration in terms of mg/ml. A...

    Please answer both 1. Often when handling proteins, we use concentration in terms of mg/ml. A high concentration is greater than 1 mg/ml and low concentrations are below 0.1 mg/ml (roughly). If you obtained a sample of MDH that was 10 micromoles/L, what is the concentration in mg/ml? Assume that the molecular weight for MDH is 32 kDa. 2. Using Beer's Law, determine the concentration of your sample if the UV-vis reading at 280 nm was 1.2 absorbance units and...

  • Perform the following Expasy analyses. Provide screenshots of analyses for both translate and protparam calculations. a)...

    Perform the following Expasy analyses. Provide screenshots of analyses for both translate and protparam calculations. a) Translate the recAgene sequence to protein using “EXPASY: translate” tool. Copy and paste the RecA protein sequence into your answer sheet. (1 point) Use “EXPASY Protparam” tool to calculate the molecular weight, number of amino acids and the theoretical pI of RecA protein as it will be expressed from the pET101-D-TOPO vector. (Clue: Copy the protein sequence into the EXPASY Protparam window. Remember to...

  • the Lambert-Beer law relates the absorption of light with the concentration and physical properties of a...

    the Lambert-Beer law relates the absorption of light with the concentration and physical properties of a substance. 5 µl of a stock protein solution was diluted to 700 µL with water in a cuvette. the absorbance at 280 nm was 0.24. the extinction coefficient ξ for the protein is 10.3 mM^-1cm^-1. what is the molar concentration of the original stock protein solution? what is the concentration of the protein solution in µg/µL if the protein molar mass is 35348 Da.

  • I forgot to put down that the observance (=OD) at 280nm is 0.679A Experiment 8: Bradford...

    I forgot to put down that the observance (=OD) at 280nm is 0.679A Experiment 8: Bradford assay and UV-method for determination of protein concentrations Materials - An ice bucket with ice, your purified sample, three visible plastic cuvettes for Bradford assay, one UV plastic cuvette for UV-method, a piece of parafilm, a Vis-spec, a Lab Quest, Bradford reagent, white tape (share), a sharpie. Bradford assay (reference 21) 1. Add 990 uk Bradford assay reagent to a plastic cuvette 2. Blank...

  • A preparation of egg white lysozyme was prepared in a buffered saline solution and measured in...

    A preparation of egg white lysozyme was prepared in a buffered saline solution and measured in a spectrophotometer at a wavelength of 280 nm, in a 1 cm path length cuvette. The absorbance was measured at 0.460. The reference solution (blank) had an absorbance of 0.125. The molar extinction coefficient (ε) at 280 nm for egg white lysozyme is approximately 36,000 M-1cm-1 Calculate the concentration of this solution? Select the correct unit. (HINT: The blank is not zero, so what...

  • need help on these Suppose you obtained the following data from two standard solutions of known...

    need help on these Suppose you obtained the following data from two standard solutions of known concentrations using a UV-Vis spectroscope: Analysis # Conc. (mg/L) 8.00 20.00 Absorbance (at 255 nm) 0.160 0.390 What is the concentration (in mg/L) of an unknown solution with an absorbance of 0.200 at 255 nm 10 points)? The unknown solution contains the same analyte as the standard solution does (Assume a path length of 1cm). 10. You prepared a stock solution by dissolving a...

  • Human myoglobin is a protein with a molar extinction coefficient at 280nm of 1.40 x 104...

    Human myoglobin is a protein with a molar extinction coefficient at 280nm of 1.40 x 104 M-1cm-1 . 100.0 uL of the stock solution of myoglobin (the tube was marked as 0.050 mg/mL) was mixed with 0.900 mL of buffer, giving an absorbance at 280nm of 0.810 (cuvette is 1.00 cm pathlength). From this information, what is the molecular weight of human myoglobin? Do you think this is a reasonable value? Explain WHY or WHY NOT?

  • Imagine that you need to perform UV-Vis spectroscopy on solutions of naphthalene. Specifically, you need to...

    Imagine that you need to perform UV-Vis spectroscopy on solutions of naphthalene. Specifically, you need to determine what molar concentration of naphthalene in a transparent solvent would allow 5% of 315 nm light to pass through a 0.5 cm cuvette. The molar extinction coefficient of naphthalene at 315 nm is 320 M−1 cm−1. Which of the following choices represents the desired concentration of naphthalene? Hint: recall the Beer-Lambert equation and the relationship between absorbance and transmittance. Answer choices: 0.008 M...

  • Multi-part question according to lab textbook: A student is analyzing crude cellular extract for protein content....

    Multi-part question according to lab textbook: A student is analyzing crude cellular extract for protein content. Crude cellular extract is simply the cellular contents obtained by lysing (breaking open) cells. Which method (A280 or biuret) would be the most appropriate method for determining protein concentration and why? A student has purified a blood protein with an extinction coefficient of 1.86 (mg cm/mL^-1) which the student compares to another blood protein which has an extinction coefficient of 0.72 (mg cm/mL^-1). Which...

ADVERTISEMENT
Free Homework Help App
Download From Google Play
Scan Your Homework
to Get Instant Free Answers
Need Online Homework Help?
Ask a Question
Get Answers For Free
Most questions answered within 3 hours.
ADVERTISEMENT
ADVERTISEMENT