Question

Image for 15. Below is the middle region of a particular polypeptide. The wild-type amino acid sequence and the sequenc The answer is C but why?
0 0
Add a comment Improve this question Transcribed image text
Answer #1

If the base substitution of one with another results in the formation of a stop codon like UAG, the translation process terminates at that point and the resulting protein is short and may be non functional. These types of mutations are known as nonsense mutations.

In case of nonsense mutation, only one single point mutation causes stop codon and it does not involve any change in the sequence of other nucleotides, which is generally caused due to frame shift mutation. In the given examples, mutant 3 is clearly indicating the occurrence of nonsense mutation at Trp codon. In case of mutant 4, amino acid sequences are changed means it is not a single point mutation, but might be a frame shift mutation. Thus, the correct option is C.

Add a comment
Know the answer?
Add Answer to:
The answer is C but why? 15. Below is the middle region of a particular polypeptide....
Your Answer:

Post as a guest

Your Name:

What's your source?

Earn Coins

Coins can be redeemed for fabulous gifts.

Not the answer you're looking for? Ask your own homework help question. Our experts will answer your question WITHIN MINUTES for Free.
Similar Homework Help Questions
  • The answer is C but why? 15. Below is the middle region of a particular polypeptide....

    The answer is C but why? 15. Below is the middle region of a particular polypeptide. The wild-type amino acid sequence and the sequence of several mutant polypeptides are given ( ... indicates additional, unspecified amino acids). Which of the five mutant polypeptides is most likely to be the result of a nonsense mutation in the corresponding gene? a. mutant 1 b. mutant 2c. mutant 3d. mutant 4e. mutant 5

  • 3. (1.8 points) The normal CFTR gene contains these six codons near the middle of the...

    3. (1.8 points) The normal CFTR gene contains these six codons near the middle of the transcript: AUU UCU VUA GCA AGA GCU... Al The corresponding amino acids in the normal CFTR protein are: (Use either the one-or three-letter amino acid codes A naint mutation changes the last nucleotide from U to C. At the DNA level, this is a transition transversion c) At the protein level, this is a (silent / missense / nonsense/frameshift ) mutation. D) Instead of...

  • 4. (4 pts) in premature termination of translation. These mutations are not as rare as you...

    4. (4 pts) in premature termination of translation. These mutations are not as rare as you might think. For example, there are 8 different sense codons that can be changed to the stop codon UAG by a single point mutation (base change). Nonsense mutations are mutations that introduce a STOP codon in place of a sense codon, and result Using the codon table in the textbook, list these 8 sense codons (and their corresponding amino acid) Consider the following introduction...

  • Below is the coding DNA sequence for a gene called tribble, including the wild-type and several...

    Below is the coding DNA sequence for a gene called tribble, including the wild-type and several mutant alleles. For each mutant allele, fully classify the mutation and its effect in the amino acid sequence. Wild-type 5'-ATGGCAACTACATATAGCACAGTTTGAACC-3' a. Mutant allele #1 5'-ATGGCAACTACATAAAGCACAGTTTGAACC-3' b. Mutant allele #2 5'-ATGGCAACTACATATAGCATAGTTTGAACC-3' c. Mutant allele #3 5'-ATGGCAACTACATACAGCACAGTTTGAACC-3' d. Which mutant allele is most likely to be a knockout and why?

  • Question 2: Transcription, RNA Processing and Translation A particular gene codes for a mature mRNA transcript...

    Question 2: Transcription, RNA Processing and Translation A particular gene codes for a mature mRNA transcript containing 1200 bases, which is translated into a protein containing 300 amino acids. A. How long is the coding sequence in this mRNA and how many nucleotides are in the UTRs? For the purposes of this question we are ignoring the G’ cap and the polyA tail. B. A mutant form of the gene created by one nucleotide being changed to another nucleotide also...

  • Please answer all.... Thank you! 81)If a polypeptide chain contains 600 amino acids, then the gene...

    Please answer all.... Thank you! 81)If a polypeptide chain contains 600 amino acids, then the gene coding for this polypeptide must contain _____. 600 nucleotides 1200 nucleotides 1800 nucleotides 1800 codons 1800 anticodons More than one of the above are correct. 82) When we altered gene triplet in the DNA produces a chain-terminating codon in the mRNA, the (1pts) result is called a reverse mutation nonsense mutation missense mutation spontaneous mutation frameshift mutation 83) A single base substitution changes the...

  • Questions 11-15: Gene structure/Splicing problem. "Protein X" consists of a total of 431 amino acids. Your...

    Questions 11-15: Gene structure/Splicing problem. "Protein X" consists of a total of 431 amino acids. Your colleague, techniques) the a biochemist, has purified the protein and determined (via complicated and messy chemical sequence of the first 37 amino acids in the protein, which she has reported to you as follows: HN- MSNITVDDELNLSREQQGFAEDDFIVIKEERETSLSP . nwhile, you have isolated a genomic clone of the gene that codes for protein X, and determined the DNA equence of the first 227 bases from the...

  • Question 20 (1 point) Figure out the mutation. You will need the codon table to answer...

    Question 20 (1 point) Figure out the mutation. You will need the codon table to answer this question. Wild type genomic sequence of a portion of a gene and the wild type sequence of portion of the protein gene product. The protein sequence only matches partially. TAT AAA GGG CGA CCA CCT GGT AAT GGG ACT TTG AGG Tyr Lys Gly Arg Pro Pro Ala Pro Arg Gin Tyr Trp Note: The five amino acids at the amino end of...

  • If the DNA template strand sequence at a particular region of a gene is 3-GGA-5. What...

    If the DNA template strand sequence at a particular region of a gene is 3-GGA-5. What amino acid would this result in after transcription and translation? Pro (Proline) Ser (Serine) Val (Valine) Arg (Arginine) Question 20 1 pts What is created during transcription? a strand of codons O a strand of tRNA a strand of anticodons a polypeptide • a strand of DNA IPS Which letter (representing a phase of the cell cycle) would you observe (S phase) synthesis and...

  • Drag each statement below to classify it as true or false to review the studies that...

    Drag each statement below to classify it as true or false to review the studies that revealed the specifics of gene function in organisms. Drag each statement below to classify it as true or false to review the studies that revealed the specifics of gene function in organisms. All Neurospora mutants unable to synthesize arginine contained the same mutation in a single gene. At least four genes control arginine Synthesis in Neurospora, and these acted on different enzymes in the...

ADVERTISEMENT
Free Homework Help App
Download From Google Play
Scan Your Homework
to Get Instant Free Answers
Need Online Homework Help?
Ask a Question
Get Answers For Free
Most questions answered within 3 hours.
ADVERTISEMENT
ADVERTISEMENT