You have carried out a two-hybrid screen with your favorite gene (which codes for your favorite protein YFP) and identified a gene that codes for a protein we’ll call “A.” YFP is only 90 amino acids long. You wish to identify which part of YFP binds to A. You construct three deletion alleles of YFP that are fused Gal4 binding domain, one contains the N-terminal 30 amino acids of YFP (1-30), one the middle 30 amino acids (31-60) and one the C-teminal 30 amino acids of YFP (61-90). You obtain the data in the figure below.

Based on this data, what is the minimum region of YFP that is required to bind to protein A?
A. amino acids 1-30
B. amino acids 31-60
C. amino acids 61-90
D. amino acids 1-60
E. amino acids 31-90
F. amino acids 1-30 and 61-90
G. amino acids 1-90
Correct answer is option C - amino acids 61-90
Explanation: YEP protein which contain amino acids 61-90 binds with A protein and and expression of 2 hybrid reporter results. When YEP contain either 1-30 amino acids or 31-60 amino acids, no expression occurs. It indicates that amino acids 61-90 is responsible for binding with the protein A. So correct answer is option C
You have carried out a two-hybrid screen with your favorite gene (which codes for your favorite...
You have identified a novel activator protein. You assume that
like other activators, your protein has activation and DNA binding
domains. You carry out deletion analysis on the part of the ORF
that codes for the C-terminal end of your activator and assay both
DNA binding and transcription. You obtain the results indicated in
the figure below. Answer the following 3 parts (i,ii, &
iii) based on this information.
i. Which most accurately describes which part of the protein
contains...
You discovered two Drosophila mutants which have identical mutant embryonic phenotypes and found out that the affected genes have similar patterns of expression. One of the affected genes (gene A) encodes a putative transcription factor, and you suspect that the second gene (gene B) may be directly controlled by this transcription factor. You have already tested the 2.5-kb fragment upstream of the start codon of the gene B using a promoter-reporter assay, and this fragment seems to be sufficient to...
Questions 11-15: Gene structure/Splicing problem. "Protein X" consists of a total of 431 amino acids. Your colleague, techniques) the a biochemist, has purified the protein and determined (via complicated and messy chemical sequence of the first 37 amino acids in the protein, which she has reported to you as follows: HN- MSNITVDDELNLSREQQGFAEDDFIVIKEERETSLSP . nwhile, you have isolated a genomic clone of the gene that codes for protein X, and determined the DNA equence of the first 227 bases from the...
QUESTION 6 Assume you are studying a protein-coding gene, ACEX, which includes 4 exons as illustrated in the gene map below. The 5' UTR and 3' UTR segments are each 25 bp long. Exons 1 thru 4 are 100, 200, 300, 400 bp long, respectively. Each intron is 200 bp each. The locations of the relevant EcoRI sites within the ACEX locus are indicated, but the location of other restriction enzyme sites (like BamHI) are not shown." EcoRI probe EcoRI...
18. Which THREE of the following six statements are true (you get 1/3 for each correct answer and minus 1/3 for each incorrect answer): Select one or more: a. GFP was originally found in algae b. GFP binds strongly and specifically to actin c. The original GFP gene has been artificially mutated to produce other colours d. CFP stands for Coral Fluorescent Protein e. Genes such as GFP can replace a native coding sequence to act as a reporter protein...
24. What would be the anticodon if the template strand of DNA Is ACC A UCC B.) TGG UGG D. ACC E. TCC 25. Prior to protein synthesis, the DNA A. attracts tRNAs with appropriate amino acids. 6.) serves as a template for the production of mRNA. C. adheres to ribosomes for protein synthesis. D. contains anticodons that become codons. E. must first undergo replication. 26. The Human Genome Project has revealed that human DNA has approximately A. 30,000 bases...
1 Overview and Background Many of the assignments in this course will introduce you to topics in computational biology. You do not need to know anything about biology to do these assignments other than what is contained in the description itself. The objective of each assignment is for you to acquire certain particular skills or knowledge, and the choice of topic is independent of that objective. Sometimes the topics will be related to computational problems in biology, chemistry, or physics,...
1. Like phospholipids, lipopolysaccharides have a hydrophilic head and a hydrophobic tail. True or false 2. The outer membrane of Gram negative bacteria contains lipopolysaccharides T or F 3. Biofilms and pure culture are formed by only one type of microorganism T or F 4. Any given antibiotic will have the same minimum inhibitory concentration (MIC) against any test microorganism. T or F 5. Production of antibiotics by the microorganism is not affected by the culture conditions T or F...
2. A dominant allele H reduces the number of body bristles that Drosophila flies have, giving rise to a “hairless” phenotype. In the homozygous condition, H is lethal. An independently assorting dominant allele S has no effect on bristle number except in the presence of H, in which case a single dose of S suppresses the hairless phenotype, thus restoring the "hairy" phenotype. However, S also is lethal in the homozygous (S/S) condition. What ratio of hairy to hairless flies...
1. According to the paper, what does lactate dehydrogenase
(LDH) do and what does it allow to happen within the myofiber? (5
points)
2. According to the paper, what is the major disadvantage of
relying on glycolysis during high-intensity exercise? (5
points)
3. Using Figure 1 in the paper, briefly describe the different
sources of ATP production at 50% versus 90% AND explain whether you
believe this depiction of ATP production applies to a Type IIX
myofiber in a human....